GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001577-TA|BGIBMGA001577-PA|IPR002290|Serine/threonine
protein kinase, IPR000719|Protein kinase, IPR011009|Protein
kinase-like
         (450 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    26   0.47 
AM292373-1|CAL23185.2|  360|Tribolium castaneum gustatory recept...    23   5.8  
AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory recept...    23   5.8  

>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 26.2 bits (55), Expect = 0.47
 Identities = 11/33 (33%), Positives = 18/33 (54%)

Query: 1   MSIKERVTVTTRHSVSPTSTVPEEQNARDPQIN 33
           +S+K+     TRHS   + T+P E+  R+   N
Sbjct: 531 VSLKQGTNTITRHSTESSLTIPFERTFRNLDAN 563


>AM292373-1|CAL23185.2|  360|Tribolium castaneum gustatory receptor
           candidate 52 protein.
          Length = 360

 Score = 22.6 bits (46), Expect = 5.8
 Identities = 7/12 (58%), Positives = 11/12 (91%)

Query: 103 QRNRSTTPEKVY 114
           ++NR+T PEK+Y
Sbjct: 23  RKNRTTCPEKIY 34


>AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory receptor
           candidate 32 protein.
          Length = 651

 Score = 22.6 bits (46), Expect = 5.8
 Identities = 7/12 (58%), Positives = 11/12 (91%)

Query: 103 QRNRSTTPEKVY 114
           ++NR+T PEK+Y
Sbjct: 23  RKNRTTCPEKIY 34


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.317    0.132    0.395 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 105,052
Number of Sequences: 317
Number of extensions: 4461
Number of successful extensions: 13
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 10
Number of HSP's gapped (non-prelim): 3
length of query: 450
length of database: 114,650
effective HSP length: 59
effective length of query: 391
effective length of database: 95,947
effective search space: 37515277
effective search space used: 37515277
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 45 (22.2 bits)