BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001575-TA|BGIBMGA001575-PA|IPR000210|BTB, IPR013069|BTB/POZ (433 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) 56 6e-08 SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) 46 6e-05 SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) 46 6e-05 SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) 46 8e-05 SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38405| Best HMM Match : BACK (HMM E-Value=0) 42 7e-04 SB_18403| Best HMM Match : BACK (HMM E-Value=0) 42 7e-04 SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) 42 0.001 SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0) 40 0.004 SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) 39 0.007 SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) 39 0.007 SB_3125| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) 38 0.012 SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) 38 0.012 SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_19151| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.021 SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0) 37 0.028 SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0) 37 0.028 SB_33955| Best HMM Match : SDA1 (HMM E-Value=0.79) 37 0.037 SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) 35 0.11 SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) 34 0.20 SB_59682| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.26 SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_21748| Best HMM Match : TPR_1 (HMM E-Value=0) 33 0.34 SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_9366| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.79 SB_34711| Best HMM Match : K_tetra (HMM E-Value=2.1e-23) 32 1.0 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 31 1.4 SB_51201| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_29494| Best HMM Match : Mpp10 (HMM E-Value=0.62) 31 1.8 SB_49477| Best HMM Match : Extensin_2 (HMM E-Value=4.1) 31 1.8 SB_20508| Best HMM Match : Filament (HMM E-Value=0.037) 31 1.8 SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 31 2.4 SB_32866| Best HMM Match : Occludin_ELL (HMM E-Value=0.25) 31 2.4 SB_59335| Best HMM Match : rve (HMM E-Value=0.0065) 30 3.2 SB_22060| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_19313| Best HMM Match : 7tm_1 (HMM E-Value=9.1e-27) 30 3.2 SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_30136| Best HMM Match : HSP20 (HMM E-Value=0.44) 30 4.2 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_10519| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.2 SB_3829| Best HMM Match : HLH (HMM E-Value=4.4e-12) 29 5.6 SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_28357| Best HMM Match : HR1 (HMM E-Value=3.2) 29 5.6 SB_58663| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_38945| Best HMM Match : TK (HMM E-Value=1.2) 29 7.3 SB_25983| Best HMM Match : IncA (HMM E-Value=0.17) 29 7.3 SB_20256| Best HMM Match : RCSD (HMM E-Value=0.41) 29 7.3 SB_19981| Best HMM Match : E1-E2_ATPase (HMM E-Value=2.3) 29 7.3 SB_12781| Best HMM Match : Spindle_assoc (HMM E-Value=0.12) 29 7.3 SB_12106| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_2628| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_34768| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_22573| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_2537| Best HMM Match : zf-C2HC5 (HMM E-Value=2.5e-28) 29 7.3 SB_39040| Best HMM Match : ChaB (HMM E-Value=4.2) 29 9.7 SB_28946| Best HMM Match : Occludin_ELL (HMM E-Value=0.27) 29 9.7 SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) 29 9.7 SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_28327| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_23539| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.7 SB_22230| Best HMM Match : CARD (HMM E-Value=3.8e-17) 29 9.7 SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) 29 9.7 >SB_49953| Best HMM Match : BTB (HMM E-Value=2.9e-18) Length = 123 Score = 56.0 bits (129), Expect = 6e-08 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 3/96 (3%) Query: 18 QRLKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFE--VLERTCEMYEDCLVMPDD 75 Q L +++CD+TL+ N L HR+VL A + YF +L E E VMPD Sbjct: 29 QVLNEMRTNSEHCDITLK-AGNLVLSAHRVVLAALSPYFRELLLPTNNEKAEKEYVMPDS 87 Query: 76 LQADVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIMK 111 L+ VV ++ F Y+G L+ L +E L + MK Sbjct: 88 LKPGAVVAMLEFFYSGTLQINLKSIEDLLAAASTMK 123 >SB_48518| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 481 Score = 46.0 bits (104), Expect = 6e-05 Identities = 29/107 (27%), Positives = 54/107 (50%), Gaps = 4/107 (3%) Query: 13 GIYFLQRLKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVLER--TCEMYEDCL 70 GI L + R CD+TL + Q+ HRLVL + + YF+ + E +ED + Sbjct: 30 GIKALMVMDDLRGRKQLCDVTLCVGER-QIVAHRLVLASFSSYFQAMFTGGLVESFEDSV 88 Query: 71 VMPDDLQADVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIMKMPVLTK 117 + D + + V +V+F YTG+L+ + ++ + S + ++ + K Sbjct: 89 TLRD-VDSGAVELLVDFAYTGKLDITTENVQSIMYASSLFQLNAIQK 134 >SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 625 Score = 46.0 bits (104), Expect = 6e-05 Identities = 27/99 (27%), Positives = 52/99 (52%), Gaps = 5/99 (5%) Query: 20 LKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMYEDC--LVMPDDLQ 77 L + CD+T++ + +++ HR+VL +C+ YF + T M E ++ L Sbjct: 24 LTQLLEQEKLCDVTIKAGER-KIRCHRVVLASCSAYFHSMF-TNSMLESSQEVITIQGLS 81 Query: 78 ADVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIMKM-PVL 115 V+ ++NFMYT ++ +D +E L S + ++ PV+ Sbjct: 82 EKSVIQLINFMYTRKITITIDNIESLLTASAVFQLDPVV 120 >SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) Length = 521 Score = 45.6 bits (103), Expect = 8e-05 Identities = 26/106 (24%), Positives = 56/106 (52%), Gaps = 4/106 (3%) Query: 14 IYFLQRLKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVL--ERTCEMYEDCLV 71 I L RL+H CD L+ ++ Q +H++V++A + YFEVL E Y D + Sbjct: 18 IGILNRLQHLRRLNTMCDAVLKVEEK-QFPIHKIVVSASSPYFEVLFSGGLRESYLDTVT 76 Query: 72 MPDDLQADVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIMKMPVLTK 117 + + ++ +++F+YTG + + +++L + ++++ + K Sbjct: 77 I-QGIDSETFSALLDFIYTGVINVNEENVQQLLPAAKMLQLDAVEK 121 >SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/96 (26%), Positives = 51/96 (53%), Gaps = 4/96 (4%) Query: 19 RLKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMYEDC--LVMPDDL 76 R + F + CD+ + D +++ H+LVL + ++YF + T +M E V D+ Sbjct: 23 RFEDFRKNSQLCDIKIVIGDK-RIRAHKLVLASFSDYFSAMF-TGDMAETSQNTVHLTDM 80 Query: 77 QADVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIMKM 112 V ++++ YT ++E R+D +E L + I+++ Sbjct: 81 DPAAVQALISYSYTSEIEIRVDNVENLLSVACILQI 116 >SB_38405| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 42.3 bits (95), Expect = 7e-04 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 4/95 (4%) Query: 20 LKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMYEDCL--VMPDDLQ 77 +K ++ CD+ L D ++ HRLVL AC++YF + T E+ E + LQ Sbjct: 32 MKQMRCNSELCDVVLLVGDR-RIYAHRLVLAACSQYFHAM-FTSELLESRQKEISLQGLQ 89 Query: 78 ADVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIMKM 112 D + +V F YT +++ D ++ L + ++++ Sbjct: 90 PDAMELLVEFAYTARIQVSEDNVQALLPAASLLQL 124 >SB_18403| Best HMM Match : BACK (HMM E-Value=0) Length = 423 Score = 42.3 bits (95), Expect = 7e-04 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 4/95 (4%) Query: 20 LKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMYEDCL--VMPDDLQ 77 +K ++ CD+ L D ++ HRLVL AC++YF + T E+ E + LQ Sbjct: 32 MKQMRCNSELCDVVLLVGDR-RIYAHRLVLAACSQYFHAM-FTSELLESRQKEISLQGLQ 89 Query: 78 ADVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIMKM 112 D + +V F YT +++ D ++ L + ++++ Sbjct: 90 PDAMELLVEFAYTARIQVSEDNVQALLPAASLLQL 124 >SB_36561| Best HMM Match : BACK (HMM E-Value=1.4013e-45) Length = 554 Score = 41.5 bits (93), Expect = 0.001 Identities = 26/105 (24%), Positives = 50/105 (47%), Gaps = 3/105 (2%) Query: 29 YCDLTLQFQDNAQLKVHRLVLNACTEYFEVLERT-CEMYEDCLVMPDDLQADVVVPIVNF 87 +CD+ L +D ++ H+LVL+A +EYF + T + + + + + + +V F Sbjct: 25 FCDVVLMTEDGQEIDAHKLVLSASSEYFRAMFLTDMKESQQKFITIRAIDSQSMTTLVEF 84 Query: 88 MYTGQLEFRLDLLEK-LYQTSLIMKMPVLTKLLKAHRASQN-PQC 130 YT + + +E LY S++ + V + R + N P C Sbjct: 85 AYTSNVRINSENVETLLYAASMLQFVRVEKACYEFLRKNINVPNC 129 >SB_37574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 4/87 (4%) Query: 27 TDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVL--ERTCEMYEDCLVMPDDLQADVVVPI 84 T CD+ L+ D HR VL +C+ YF + E + + M D L D + + Sbjct: 9 TKLCDVVLRI-DEQSYAGHRAVLASCSAYFYAMFNGELAESKQKIITMKDILP-DYMQVL 66 Query: 85 VNFMYTGQLEFRLDLLEKLYQTSLIMK 111 V F YTG++E ++ ++ L T+ +++ Sbjct: 67 VEFAYTGRVEITVENVQNLLATASLLQ 93 >SB_56342| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 651 Score = 39.9 bits (89), Expect = 0.004 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 4/85 (4%) Query: 30 CDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMYEDCL--VMPDDLQADVVVPIVNF 87 CD+TL +D + L HR+VL + YF + T +M E L V ++ + ++NF Sbjct: 32 CDVTLVVKDRS-LVSHRVVLAGWSPYFHAM-LTGDMLESRLEKVTIHGIECAALEELINF 89 Query: 88 MYTGQLEFRLDLLEKLYQTSLIMKM 112 YTG+ E ++ ++ L S ++++ Sbjct: 90 CYTGRTEIHVENVQSLMCASSLLQL 114 >SB_54322| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 587 Score = 39.1 bits (87), Expect = 0.007 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 8/104 (7%) Query: 30 CDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMYEDCL--VMPDDLQADVVVPIVNF 87 CD+TL + + HR+VL A ++YF L T EM E V +L+A V+ I+ + Sbjct: 30 CDVTLVVEGK-EFPAHRIVLAASSKYFYGLF-TSEMIEKNAPSVKLQELRASVMNHILTY 87 Query: 88 MYTGQLEFRLDLLEKLYQTSLIMKMP----VLTKLLKAHRASQN 127 +YTG++ E L ++ + +P + K L+ H S N Sbjct: 88 LYTGEITVTELNAEDLIASANYLLIPRLKGIACKYLERHMTSSN 131 >SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 590 Score = 39.1 bits (87), Expect = 0.007 Identities = 25/102 (24%), Positives = 49/102 (48%), Gaps = 2/102 (1%) Query: 10 DNWGIYFLQRLKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYF-EVLERTCEMYED 68 D + L R+ + CD+ ++ +D L HR +L+A ++YF + + Sbjct: 14 DKYSKAILHRINQLRHHGAMCDVVIKAEDTEFL-AHRNILSASSDYFFAMFNGNMKESSQ 72 Query: 69 CLVMPDDLQADVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIM 110 +V + D + I+NF+YTG++ D +E + Q + +M Sbjct: 73 DVVTITGVTPDSMRSILNFIYTGEIVLDWDNVELILQGANLM 114 >SB_3125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1268 Score = 38.3 bits (85), Expect = 0.012 Identities = 28/123 (22%), Positives = 59/123 (47%), Gaps = 4/123 (3%) Query: 289 LKKNKPIMDSNQLFDQILDQNDAPKITIDTKNSKVSANLDHAKIISEVLKKYSHL-LKGS 347 LK+ K ++++ + + K+T+ K +K S ++D I S+ KK +H+ + Sbjct: 640 LKEIKKEKNNDRNVKSTEQERNIAKVTVYNKKAKKSVSIDKQTISSDKHKKSTHMNNEVK 699 Query: 348 KNIKLKILNTPNKKKQSTVREQKNSQQKV-ERHDSNFTYETDVIDSKHAAKLIAMGAENI 406 K++ LKI N ++ + + + ++V E H N E D +H +K ++ ++ Sbjct: 700 KSVSLKIKKEKNTEQHNKIASAADKVEEVNEYHSVNIKKEKK--DREHKSKKLSENIADM 757 Query: 407 NGP 409 P Sbjct: 758 KVP 760 >SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) Length = 690 Score = 38.3 bits (85), Expect = 0.012 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 11/112 (9%) Query: 289 LKKNKPIMDSNQLFDQILDQNDAPKITIDTKNSKVSANLDHAKIISEVLKKYSHLLKGSK 348 LK K + + +L I ++++ K+ + K A D ++ E KY+ +LK K Sbjct: 399 LKNKKLLQEKRELL--IKNRDEFTKL----EEEKQKAVYDLTAMLDEKQAKYTSMLKDLK 452 Query: 349 NIKLKILNTPNKKKQSTVREQKNSQQKVERHDSNFTYETD--VIDSKHAAKL 398 N + KI+ K K E++NSQ++ E + T+E + V+ +KH +L Sbjct: 453 NERNKIIELEEKLK---ALEEQNSQRQEEYDSNKSTHENELLVLKAKHEEEL 501 >SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2201 Score = 38.3 bits (85), Expect = 0.012 Identities = 21/99 (21%), Positives = 44/99 (44%) Query: 19 RLKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMYEDCLVMPDDLQA 78 +L + CD+TL+ H++VL A ++YF+ L T ++C + D+ Sbjct: 18 QLMQYQESESMCDITLKTTSEDIFPAHKIVLAAKSDYFKALFTTEMAEKNCQEISLDIST 77 Query: 79 DVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIMKMPVLTK 117 + I+ ++Y G + + ++ + + M L K Sbjct: 78 RTLKAILKYVYCGDVSLNVSNARSVFVAADYLMMDHLKK 116 >SB_2676| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 645 Score = 38.3 bits (85), Expect = 0.012 Identities = 24/95 (25%), Positives = 48/95 (50%), Gaps = 4/95 (4%) Query: 20 LKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMYED--CLVMPDDLQ 77 L R + CD+ L N Q+ HR+VL+AC+ YF+ + T + E ++ + Sbjct: 22 LNQLRQRKELCDVELCV-GNVQISAHRVVLSACSAYFDAM-FTGNLLESKKQVIYIKGID 79 Query: 78 ADVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIMKM 112 + +V+F YTG+ E + ++ L + ++++ Sbjct: 80 ETALQLLVDFAYTGKAEITQENVQLLLPAANMLQL 114 >SB_6593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 37.9 bits (84), Expect = 0.016 Identities = 23/90 (25%), Positives = 46/90 (51%), Gaps = 3/90 (3%) Query: 30 CDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCE--MYEDCLVMPDDLQADVVVPIVNF 87 CD+TL+ + ++ H++VL A + YF L E Y + +P V ++N+ Sbjct: 48 CDVTLRHNER-RIPCHKVVLAARSPYFRHLFINSESGQYVKNVELPSYFSILAVDEVINY 106 Query: 88 MYTGQLEFRLDLLEKLYQTSLIMKMPVLTK 117 +Y+G+L F +++ +L +++ L K Sbjct: 107 LYSGKLHFTPTNTVDIFKCALHIELDALVK 136 >SB_13053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 581 Score = 37.9 bits (84), Expect = 0.016 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 4/97 (4%) Query: 18 QRLKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVL--ERTCEMYEDCLVMPDD 75 Q+ F N + CD+ L D ++ H+LVL A + YF + E + + + D Sbjct: 21 QQFNDFRNSKELCDVLLCVDDE-EIPSHKLVLAASSPYFRAMFTSNLLECTQRTITL-YD 78 Query: 76 LQADVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIMKM 112 + + IV + YTG++ D ++ L S ++++ Sbjct: 79 IDVGALQQIVEYFYTGKITIDEDNVQFLLHASCLLQV 115 >SB_19151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 37.5 bits (83), Expect = 0.021 Identities = 24/99 (24%), Positives = 48/99 (48%), Gaps = 3/99 (3%) Query: 17 LQRLKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMYED--CLVMPD 74 LQ L + CD+TL+ +D + VHR VL A + YF + T + E ++ Sbjct: 69 LQGLFSQIGLKELCDVTLETEDGLSIAVHRNVLAAVSPYFRAM-FTGNLLESGKNRILLK 127 Query: 75 DLQADVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIMKMP 113 + + +++++YT +E D +E++ + ++P Sbjct: 128 GIAGVALQALLDYVYTSSIEIFDDNVEEVLNAACAFQIP 166 >SB_38111| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 548 Score = 37.1 bits (82), Expect = 0.028 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 3/86 (3%) Query: 11 NWGIYFLQRLKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVL--ERTCEMYED 68 N+ + +Q L F C++T+ + HR VL A + YF + E E Sbjct: 31 NYCVALMQCLNDFRKHNVLCEVTIVV-NGKPFYAHRNVLAAASPYFRAMFSSHFREQNES 89 Query: 69 CLVMPDDLQADVVVPIVNFMYTGQLE 94 V+ +++ ADV+ ++NF+Y G ++ Sbjct: 90 KPVILENITADVMEELLNFIYAGTIK 115 >SB_33742| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 570 Score = 37.1 bits (82), Expect = 0.028 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 3/86 (3%) Query: 11 NWGIYFLQRLKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVL--ERTCEMYED 68 N+ + +Q L F C++T+ + HR VL A + YF + E E Sbjct: 31 NYCVALMQCLNDFRKHNVLCEVTIVV-NGKPFYAHRNVLAAASPYFRAMFSSHFREQNES 89 Query: 69 CLVMPDDLQADVVVPIVNFMYTGQLE 94 V+ +++ ADV+ ++NF+Y G ++ Sbjct: 90 KPVILENITADVMEELLNFIYAGTIK 115 >SB_33955| Best HMM Match : SDA1 (HMM E-Value=0.79) Length = 258 Score = 36.7 bits (81), Expect = 0.037 Identities = 30/141 (21%), Positives = 61/141 (43%), Gaps = 3/141 (2%) Query: 186 NKKNLMTDPKPTRYELSEEFDGDGVFDSSFCNISYTSQPLMVHPDTKKRYSKKSGLFNNS 245 N ++ D E + D DGV +F + +T++ + T+ +++ L S Sbjct: 106 NDNDVEDDDDDEEEEDGDNDDNDGV--DAFVELEFTNKLSKLAQTTRAAITEERFLPFQS 163 Query: 246 SSDSKHTTTLDIIE-CKKSVDNIFEDNYLESGILDENEMFQTTYLKKNKPIMDSNQLFDQ 304 + ++ E C K+ ++ +LE+ + + E + TY+++N+ + S QL D Sbjct: 164 IFVTALDQDIEYSEKCAKTYSSLLSTKFLENEAITKLEKAKQTYIQRNQELDKSKQLLDA 223 Query: 305 ILDQNDAPKITIDTKNSKVSA 325 Q + T TK + A Sbjct: 224 KDGQEPSASYTRTTKKKQDDA 244 >SB_28350| Best HMM Match : BTB (HMM E-Value=1.1e-38) Length = 518 Score = 35.1 bits (77), Expect = 0.11 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 4/85 (4%) Query: 31 DLTLQFQDNAQLKVHRLVLNACTEYFEVLERT--CEMYEDCLVMPDDLQADVVVPIVNFM 88 D+TL Q ++K HR+VL AC+ YF + T E + + + + V IV + Sbjct: 40 DVTLHVQGE-EIKAHRVVLAACSPYFRAMLTTGFAETFMSTIPL-HECDPVGVQSIVEYF 97 Query: 89 YTGQLEFRLDLLEKLYQTSLIMKMP 113 Y+ +L + +E L + + ++P Sbjct: 98 YSKRLTITKENIEGLLSAASLFEIP 122 >SB_45623| Best HMM Match : BTB (HMM E-Value=1.4e-36) Length = 574 Score = 34.3 bits (75), Expect = 0.20 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 2/88 (2%) Query: 30 CDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMY-EDCLVMPDDLQADVVVPIVNFM 88 CD+ L +N + H+ +L A + YF + T + E V+ L+ VV I++F+ Sbjct: 41 CDVVL-LVENEEFSAHKGILAANSHYFMAMFTTDMIEKEQERVILKKLKPSVVKEILDFL 99 Query: 89 YTGQLEFRLDLLEKLYQTSLIMKMPVLT 116 YTG++E + L + S + + +T Sbjct: 100 YTGRIEIDNKNVRDLLEASSFLIISSVT 127 >SB_59682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.26 Identities = 27/115 (23%), Positives = 46/115 (40%), Gaps = 4/115 (3%) Query: 83 PIVNFMYTGQLEFRLDLLEKLYQTSLIMKMPVLTKLLK---AHRASQNPQCYAPKHKSSE 139 PI N MY + R + K+Y+ S+ + P+ K+ + +HR + + Y P Sbjct: 26 PISNKMYEPSVTHRTPISNKMYEPSVTHRTPISNKMYEPSVSHRTPISNKMYEPSVTHRT 85 Query: 140 PTPSTSNKRSYGKAFDNKSACKEKKVYKPVNINKEIMYRPSSPYIQNKKNLMTDP 194 P + + S + E V I+ + MY PS + N M +P Sbjct: 86 PISNKMYEPSVSHRTPISNKMYEPSVTHRTPISNK-MYEPSVTHRTPISNKMYEP 139 Score = 31.5 bits (68), Expect = 1.4 Identities = 32/121 (26%), Positives = 50/121 (41%), Gaps = 10/121 (8%) Query: 83 PIVNFMYTGQLEFRLDLLEKLYQTSLIMKMPVLTKLLK---AHRASQNPQCYAPKHKSSE 139 PI N M + R + K+Y+ S+ + P+ K+ + HR + + Y P S Sbjct: 11 PISNKMCEPSVTHRTPISNKMYEPSVTHRTPISNKMYEPSVTHRTPISNKMYEP--SVSH 68 Query: 140 PTPSTSNKRSYGKAFDNKSACKEKKVYKPVNINKEI---MYRPSSPYIQNKKNLMTDPKP 196 TP SNK Y + +++ K V+ I MY PS + N M +P Sbjct: 69 RTP-ISNK-MYEPSVTHRTPISNKMYEPSVSHRTPISNKMYEPSVTHRTPISNKMYEPSV 126 Query: 197 T 197 T Sbjct: 127 T 127 >SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 33.5 bits (73), Expect = 0.34 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 4/63 (6%) Query: 30 CDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMYED--CLVMPDDLQADVVVPIVNF 87 CD+ LQ + + HR+VL +C++YF + T +M E ++ L +D + +++F Sbjct: 38 CDVVLQVEKK-EFPAHRIVLASCSDYFYAM-FTNDMLESQKGVIELQGLASDTMEVLLDF 95 Query: 88 MYT 90 +YT Sbjct: 96 VYT 98 >SB_21748| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 373 Score = 33.5 bits (73), Expect = 0.34 Identities = 19/95 (20%), Positives = 42/95 (44%), Gaps = 1/95 (1%) Query: 275 SGILDENEMFQTTYLKKNKPIMDSNQLFDQILDQNDAPKITIDTKNSKVSANL-DHAKII 333 + ++D+ Y +K + D + + + A ++ I T N A + + ++ Sbjct: 2 ANVMDKRNEQAQVYFRKGNELYDLGKHREALEQYQQALQVCISTGNESDQAGVRQNIGVL 61 Query: 334 SEVLKKYSHLLKGSKNIKLKILNTPNKKKQSTVRE 368 E L Y +K + + ++T N+ KQ+ VR+ Sbjct: 62 QESLGNYEEAMKYYQQVLQVYISTGNESKQADVRQ 96 >SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 658 Score = 33.1 bits (72), Expect = 0.45 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 4/90 (4%) Query: 29 YCDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTC--EMYEDCLVMPDDLQADVVVPIVN 86 +CD+ LQ + VHR VL A + +F + + E + L + ++A + I+ Sbjct: 55 FCDVILQVEGR-HYPVHRCVLAANSPFFYTMFNSGMKESMQQTLQL-QSIKAKAMESILE 112 Query: 87 FMYTGQLEFRLDLLEKLYQTSLIMKMPVLT 116 F YT ++ D L L + + +P LT Sbjct: 113 FFYTQEIVLEEDELLDLLDAASFLLLPALT 142 >SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 33.1 bits (72), Expect = 0.45 Identities = 23/101 (22%), Positives = 42/101 (41%), Gaps = 5/101 (4%) Query: 279 DENEMFQTTYLKKNKPIMDSNQLFDQILDQ-----NDAPKITIDTKNSKVSANLDHAKII 333 ++N F + + P DS Q+F Q+ + +D + + NSK +L K+ Sbjct: 382 EQNNDFHNSDDEDTGPYFDSEQMFQQLNHEVLGVDDDEDSVNDEENNSKTGNDLYKKKLY 441 Query: 334 SEVLKKYSHLLKGSKNIKLKILNTPNKKKQSTVREQKNSQQ 374 + KYS K + +L+ + N Q ++ N Q Sbjct: 442 HKAFTKYSRATKLLEECRLQNEDEENMMNQVLLKLYSNMSQ 482 >SB_9366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1221 Score = 32.7 bits (71), Expect = 0.60 Identities = 33/128 (25%), Positives = 54/128 (42%), Gaps = 4/128 (3%) Query: 138 SEPTPSTSNKRSYGKAFDNKSACKEKKVYKPVNINKEIMYRPSSPYIQNKKNLMTDP--K 195 +E TS RS K+ + ++ EKK+ + E PSSP + KK + P K Sbjct: 895 TERAVPTSALRSPDKSPNKRAGSLEKKI-DAIKAKLESSKNPSSPQTEVKKRIGRPPGSK 953 Query: 196 PTRYELSEEFDGDGVFDSSFCNISYTSQPLMVHPDTKKRYSKKSGLFNNSSSDSKHTTTL 255 + S + ++ +S TS+ TK +SK + +S+ SK T+ Sbjct: 954 DKQKRRSYRTHKKLMLENEEPEVSKTSKHRN-EKQTKHGHSKTASTEGEASTSSKRPLTI 1012 Query: 256 DIIECKKS 263 DI K+ Sbjct: 1013 DIPTVSKA 1020 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 32.3 bits (70), Expect = 0.79 Identities = 30/135 (22%), Positives = 58/135 (42%), Gaps = 10/135 (7%) Query: 256 DIIECKKSVDNIFEDNYLESGILD--ENEMFQTTYLKKNKPIMDSNQ-LFDQILDQNDAP 312 ++ K S N ++ NY+E G LD + E+ + + N+ + + NQ L DQ + Sbjct: 2625 ELSSAKASEKNYYDQNYVEKGQLDAYKKELDAKSRFEINRKLEEVNQHLADQAASRE--- 2681 Query: 313 KITIDTKNSKVSANLDHAKIISEVLKKYSHLLKGSKNIKLKILNTPNKKKQSTVR---EQ 369 K+ + + + + + IS + Y + LK + ++ K +S E+ Sbjct: 2682 KLELMREQNAAKTRAELEQTISSLKDLYENELKAKDKLTNRLARANEKVAESKALLNIER 2741 Query: 370 KNSQQKVERHDSNFT 384 Q +R D+ FT Sbjct: 2742 SRRLQSADR-DTGFT 2755 >SB_34711| Best HMM Match : K_tetra (HMM E-Value=2.1e-23) Length = 124 Score = 31.9 bits (69), Expect = 1.0 Identities = 19/68 (27%), Positives = 33/68 (48%) Query: 46 RLVLNACTEYFEVLERTCEMYEDCLVMPDDLQADVVVPIVNFMYTGQLEFRLDLLEKLYQ 105 R+VLN E FE ERT E + + L+ ++ + P + Y + + D + YQ Sbjct: 12 RIVLNIRGERFETFERTLEQFPETLLGSENRRMPYFRPDLREYYFDRDKVSFDAILFYYQ 71 Query: 106 TSLIMKMP 113 ++ I+ P Sbjct: 72 SNGILARP 79 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 31.5 bits (68), Expect = 1.4 Identities = 19/93 (20%), Positives = 45/93 (48%), Gaps = 4/93 (4%) Query: 28 DYCDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMYE--DCLVMPDDLQADVVVPIV 85 + CD+ ++ ++ + HR+VL AC+ YF + T EM E + D+ + ++ Sbjct: 57 ELCDVVIKV-GSSTIHAHRVVLAACSPYFRAM-FTREMAESRQAEITIRDVDESAMNLLI 114 Query: 86 NFMYTGQLEFRLDLLEKLYQTSLIMKMPVLTKL 118 F YT + ++ L + ++++ + ++ Sbjct: 115 TFAYTASITIEETNVQTLLPAACLLQLTEIQEI 147 >SB_51201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.1 bits (67), Expect = 1.8 Identities = 23/104 (22%), Positives = 45/104 (43%), Gaps = 12/104 (11%) Query: 163 KKVYKPVNINKEIMYRPSSPYIQNKKNLMTDPKPTRYELSEEFDGDGVFDSSFCNISYTS 222 K + + N+ I+ P + + ++ ++T + L+ EF GD + +FC + Sbjct: 35 KDIIRITNVTFSILPSPKNHHFYHRHQIITIKEVCTLSLATEFGGDEMNIVNFCGLVLCL 94 Query: 223 QPLMVHPDTKKRYSKKSGLFNNSSSDSKHTTTLDIIECKKSVDN 266 + VH + N+S DS++ + I KKS+ N Sbjct: 95 TGIAVH------------VVTNASKDSENGKEFEKINLKKSLIN 126 >SB_29494| Best HMM Match : Mpp10 (HMM E-Value=0.62) Length = 631 Score = 31.1 bits (67), Expect = 1.8 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Query: 289 LKKNKPIMDSNQLFDQILDQNDAPKITIDTKNSKVSANLDHAKIISEVLKKYSHLL--KG 346 + K KP+ +++ + D+ D K T+N K S L + K +L K Sbjct: 492 ISKPKPVSETDSILDKKADIVKNVKKASATQNGKQSKILGKVDARKRLSAKTVPVLSKKI 551 Query: 347 SKNIKLKILNTPNKKKQSTVREQKN 371 S NIK K+L+T + K++ E+++ Sbjct: 552 SINIKTKVLSTKQEAKETVRGEEED 576 >SB_49477| Best HMM Match : Extensin_2 (HMM E-Value=4.1) Length = 346 Score = 31.1 bits (67), Expect = 1.8 Identities = 27/109 (24%), Positives = 49/109 (44%), Gaps = 11/109 (10%) Query: 102 KLYQTSLIMKMPVLTKLLKAHRASQNPQCYA--PKH-KSSEPTPSTSNK--RSYGKAFDN 156 K+ Q M PVL + + + + Q Y P++ + P P T K + A++ Sbjct: 230 KIRQPPTPMSAPVLVQKARTRKPLKLAQAYTGYPEYIMNKAPPPVTVRKMRKKVTTAYEG 289 Query: 157 --KSACKEKKVYKPV----NINKEIMYRPSSPYIQNKKNLMTDPKPTRY 199 + C+E +V P+ +NKE+M+ P P +K+ P+R+ Sbjct: 290 YPEYICQETRVRIPIWDSAKVNKEVMFLPPIPDPYSKRRPRDAGTPSRH 338 >SB_20508| Best HMM Match : Filament (HMM E-Value=0.037) Length = 722 Score = 31.1 bits (67), Expect = 1.8 Identities = 23/100 (23%), Positives = 48/100 (48%), Gaps = 7/100 (7%) Query: 276 GILDENEMFQTTYLKKNKPIMDSNQLFDQILDQNDAPKITIDTKNSKVSANLDHAKIISE 335 G+ E + + + K + ++ +++ + D K D K+ +VSA I + Sbjct: 351 GVRSELKQKTSDVTRLAKELEETKIAMEELSQERDLMKELADAKDIEVSA------IQGQ 404 Query: 336 VLKKYSHLLKGSKNIK-LKILNTPNKKKQSTVREQKNSQQ 374 + K S + K ++ ++ LKIL K++ +E +N+QQ Sbjct: 405 ITDKSSQIAKLARELEALKILQDSTAKERDFYKEHENAQQ 444 >SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1227 Score = 30.7 bits (66), Expect = 2.4 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 139 EPTPSTSNKRSYGKAFDNKSACKEKKVYKPVNINKEIMYRPSSP 182 EP STS +R YG A +K A E+ Y+P + R +SP Sbjct: 918 EPQGSTSAQRPYGSAEPDKQAA-EQAAYEPARAPSALAERITSP 960 >SB_32866| Best HMM Match : Occludin_ELL (HMM E-Value=0.25) Length = 1034 Score = 30.7 bits (66), Expect = 2.4 Identities = 45/191 (23%), Positives = 76/191 (39%), Gaps = 10/191 (5%) Query: 213 SSFCNISYTSQPLMVHPDTKKRYSKKSGLFNNSSSDSKHTTTLDIIECKKSVDNIFEDNY 272 SS I T+ + V K + + + N ++ K T I E ++ + N F+ Sbjct: 15 SSGTAIRKTADRVFVIRKLKTKNAAQHKTIENYKTEVKIKNT-KISELEEQIKN-FQQQK 72 Query: 273 L-----ESGILDENEMFQTTYLKKNKPIMDSNQLFDQILDQNDAPKITIDTKNSKVSANL 327 L ES E E + KNK + D ++ ++ + K + + ++ Sbjct: 73 LKSQSHESDNAKEIERLKAALEAKNKQMYDLEEIVRSSAEKMEQMKKEFEDEKQRMQKEF 132 Query: 328 DHAKIISEVLKKYSHLLKGSKNIKLKILNTPNKKKQSTVREQKNSQQKVERHDSNFTYET 387 + S K K K LK+ K S RE+++ +++ R T ET Sbjct: 133 EKNLEESAANFKIEIAEKDEKLNVLKMRMADALKDNS--RERQHQLEELTRELKRVTEET 190 Query: 388 DVIDSK-HAAK 397 DV+ SK HAAK Sbjct: 191 DVLRSKIHAAK 201 >SB_59335| Best HMM Match : rve (HMM E-Value=0.0065) Length = 1020 Score = 30.3 bits (65), Expect = 3.2 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 139 EPTPSTSNKRSYGKAFDNKSACKEKKVYKPVNINKEIMYRPSSP 182 EP STS +R YG A +K A E+ +KP + R +SP Sbjct: 527 EPQGSTSAQRPYGSAEPDKQAA-EQAAHKPARTPSALAERITSP 569 >SB_22060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 842 Score = 30.3 bits (65), Expect = 3.2 Identities = 27/117 (23%), Positives = 48/117 (41%), Gaps = 3/117 (2%) Query: 295 IMDSNQLFDQILDQNDAPKITIDTKNSKVSANLDHAKIISEVLKKYSHLLKGSKNIKLKI 354 I DS Q +++N+ K DT K+S ++ K S LLK K + Sbjct: 399 IADSKAAISQNVNKNE-DKDKDDTVTLKISGKGKPVSFNADASKDGSILLKIPKKFSEDL 457 Query: 355 LNTPNKKKQSTVREQKNSQQKVERHDSNFTYETDVIDSKHAAKLIAMGAENINGPWI 411 + KK+ +++ + K E D + D + KH +L + + I+ W+ Sbjct: 458 IEDVESKKKKAESKKQMPRPKEEEEDEDDADSRD-LKGKHLPRLSSGNSPTISS-WV 512 >SB_19313| Best HMM Match : 7tm_1 (HMM E-Value=9.1e-27) Length = 545 Score = 30.3 bits (65), Expect = 3.2 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Query: 318 TKNSKVSANLDHAKIISEVLK--KYSHLLKGSKNIKLKILNTPNKKKQSTVREQKNSQQK 375 TK K A H K ISEV + K + + G N N+ ++R +K + + Sbjct: 380 TKGYKCHALTFHMKSISEVFQKSKIKYRIDGCAEAHAMQTNKWNEHDSLSLRRRKKTNKN 439 Query: 376 VERHDSNFTYETDVIDSKHAA 396 ++ + Y D+I ++ +A Sbjct: 440 IDAITKEYRYNIDIILAEPSA 460 >SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 999 Score = 29.9 bits (64), Expect = 4.2 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 6/78 (7%) Query: 135 HKSSEPTPSTSNKRSYGKAF--DNKSACKEKKVYKPVNINKEIMYRPSSPYIQNKKNLMT 192 H SS T N+R+ G+ F K+ K++K + + K + SP + Sbjct: 296 HHSSRATEKLKNRRNEGERFAVSRKTNLKDEKENEKSQLEKPV----PSPRGHKTSGPLH 351 Query: 193 DPKPTRYELSEEFDGDGV 210 + + RYE E DG+ V Sbjct: 352 NKRDARYEEESEDDGEDV 369 >SB_30136| Best HMM Match : HSP20 (HMM E-Value=0.44) Length = 233 Score = 29.9 bits (64), Expect = 4.2 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Query: 332 IISEVLKKYSHLLKGSKNIKLKILNTPNKKK--QSTVREQKNSQQKVERHDSNFTYETDV 389 ++SE +K S K S+ ++ P K+ Q R QK SQ K+E+ D+ T T Sbjct: 111 VLSEEVKPDSSSAKRSQTTGHLLITMPKMKETIQPVKRVQKISQPKLEQKDTKTTNPTVQ 170 Query: 390 IDSKH 394 +KH Sbjct: 171 QGTKH 175 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 29.9 bits (64), Expect = 4.2 Identities = 22/76 (28%), Positives = 42/76 (55%), Gaps = 5/76 (6%) Query: 303 DQILDQNDAPKITIDTKNSKVSANLDHAKIISEVLK-KYSHLLKGSKNIKLKILNTPNKK 361 + +LD+ A K ++ +N + A+LD A+ +++LK S LLK ++K N N+ Sbjct: 556 EALLDKLRATKDYLEEQNESLKASLDAARDSNDLLKADQSKLLKEIADLK----NDKNQL 611 Query: 362 KQSTVREQKNSQQKVE 377 KQ+ + + ++ VE Sbjct: 612 KQANQKLGHDRERAVE 627 >SB_10519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 873 Score = 29.9 bits (64), Expect = 4.2 Identities = 19/80 (23%), Positives = 43/80 (53%), Gaps = 4/80 (5%) Query: 308 QNDAPKITIDTKNSKVSANLDHAKIISEVLKKYSHLLKGSKNIKLKILNTP---NKKKQS 364 Q+ + + + N +S + D+ +I + L+KY + SK + K+ +T +K ++S Sbjct: 107 QSFSDNLANNIANRFMSMSDDYQRISKKKLRKYHTMFGESKTAESKLKSTEIALSKSEES 166 Query: 365 TVREQKNSQQKVERHDSNFT 384 + +K ++QK E+H ++ Sbjct: 167 GRKNEKMTKQK-EKHQQRYS 185 >SB_3829| Best HMM Match : HLH (HMM E-Value=4.4e-12) Length = 1650 Score = 29.5 bits (63), Expect = 5.6 Identities = 13/44 (29%), Positives = 21/44 (47%) Query: 115 LTKLLKAHRASQNPQCYAPKHKSSEPTPSTSNKRSYGKAFDNKS 158 +TK+ KA + NP Y+ S P P+ + + K DN + Sbjct: 1006 ITKVTKAFEKAANPATYSANPISKSPDPAAKSVNTVTKTTDNST 1049 >SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 29.5 bits (63), Expect = 5.6 Identities = 25/101 (24%), Positives = 42/101 (41%), Gaps = 4/101 (3%) Query: 17 LQRLKHFFNRTDYCDLTLQFQDNAQLKVHRLVLNACTEYFEVLERTCEMYEDCL--VMPD 74 L RL CD +Q VH+ VL A + +F L T +M E + Sbjct: 22 LDRLNSLRKENVLCDAVIQIGGKTH-PVHKNVLCAASPFFRGLF-TNDMQEKNQEHIELQ 79 Query: 75 DLQADVVVPIVNFMYTGQLEFRLDLLEKLYQTSLIMKMPVL 115 + DV +++FMYTG ++ + + + + +P L Sbjct: 80 VISGDVGEEVISFMYTGAIKVEKENAQDIVMAGDFLLIPSL 120 >SB_28357| Best HMM Match : HR1 (HMM E-Value=3.2) Length = 123 Score = 29.5 bits (63), Expect = 5.6 Identities = 24/106 (22%), Positives = 51/106 (48%), Gaps = 6/106 (5%) Query: 289 LKKNKPIMDSNQLFDQILDQNDAPKITIDTKNSKVSANLDHAKIISEVLKKYSHLLKGSK 348 LK P S+ + + + I + T+ + +N+++ + +V++ S+ + Sbjct: 10 LKNTVPYQSSSSITSWSFEPDVLKNIGV-TRMPETRSNVENCRAKRKVVR--SNCTRNIN 66 Query: 349 NIKLKILNTPNKKKQSTVREQKNSQQKVERHDSNFTYETDVIDSKH 394 IK ++L P+KK +S VR+ N+ +V T E + +D +H Sbjct: 67 KIK-ELL--PDKKNKSKVRQFANNLDEVRGKARELTAELEELDPEH 109 >SB_58663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 29.1 bits (62), Expect = 7.3 Identities = 23/133 (17%), Positives = 48/133 (36%) Query: 261 KKSVDNIFEDNYLESGILDENEMFQTTYLKKNKPIMDSNQLFDQILDQNDAPKITIDTKN 320 ++ + I +N + DE+ ++ K M+ L D K+ +T Sbjct: 407 EEKIAKIKNENQRALALKDEDAQKLMKETEELKAKMEDEHQKALGLKDEDIQKLMKETDE 466 Query: 321 SKVSANLDHAKIISEVLKKYSHLLKGSKNIKLKILNTPNKKKQSTVREQKNSQQKVERHD 380 K +H K + + L+K ++ +K K+ +K ++ +QK E Sbjct: 467 LKAKMEDEHQKALGLKDEDAQRLIKETEELKAKMAEIEEARKGEVAMAEEERRQKAEEQK 526 Query: 381 SNFTYETDVIDSK 393 + E + K Sbjct: 527 KSMDAEIHELKRK 539 >SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6116 Score = 29.1 bits (62), Expect = 7.3 Identities = 11/37 (29%), Positives = 21/37 (56%) Query: 301 LFDQILDQNDAPKITIDTKNSKVSANLDHAKIISEVL 337 LF ++DQND P +T +++ NL +++ V+ Sbjct: 1983 LFVTVVDQNDTPVLTGSPYTARIEENLSSGGVVAHVV 2019 >SB_38945| Best HMM Match : TK (HMM E-Value=1.2) Length = 258 Score = 29.1 bits (62), Expect = 7.3 Identities = 35/157 (22%), Positives = 67/157 (42%), Gaps = 9/157 (5%) Query: 235 YSKKSGLFNNSSSDSKHTTTLDIIECKKSVDNIFE--DNYLESGILDENEMF--QTTY-- 288 Y + + NN + + D I K D I E DN ++S LD+ + + + Y Sbjct: 61 YRDEGIVLNNDWINQYNRADNDEINEKVQSDTIDETDDNDIDSEGLDQIDKYCEELAYPG 120 Query: 289 LKKNKPIMDSNQLFDQILDQNDAPKITIDTKNSKVSANLDHAKIISEVLKKYSHLLKGSK 348 + +P +D+ Q +++D N + + + S A + I + K +L G Sbjct: 121 IFLGQPRIDNKQ---RLVDINYSDICKSELRRSDRRAAVCIENIFYKTKKLQMKILLGKS 177 Query: 349 NIKLKILNTPNKKKQSTVREQKNSQQKVERHDSNFTY 385 +I L+ NK + +Q+ S ++ RHD + + Sbjct: 178 HIALRKCKGNNKNITAGQLKQQGSIDRLIRHDDGYKF 214 >SB_25983| Best HMM Match : IncA (HMM E-Value=0.17) Length = 385 Score = 29.1 bits (62), Expect = 7.3 Identities = 26/101 (25%), Positives = 44/101 (43%), Gaps = 3/101 (2%) Query: 298 SNQLFDQILDQNDAPKITIDTKNSKVSANLDHAKIISEVLKKYSHLLKGSKNIKLKILNT 357 +N + ++ N IT T S+ ++ + AK S + S + G +++N Sbjct: 205 ANNASNDVVKANQTIAIT-PTNKSQTASPVTQAKPTSPTTEADSDVQNGDAK-SAQLVNK 262 Query: 358 P-NKKKQSTVREQKNSQQKVERHDSNFTYETDVIDSKHAAK 397 P N KKQ + EQK + +K D T E + +D K Sbjct: 263 PDNAKKQESEVEQKITGKKKTIGDLENTVEQEDMDHNEEKK 303 >SB_20256| Best HMM Match : RCSD (HMM E-Value=0.41) Length = 247 Score = 29.1 bits (62), Expect = 7.3 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Query: 319 KNSKVSANLDHAKIISEVLKKYSHLLKGSKNIKLKILNTPNKKKQSTVREQKNSQQKVE 377 KN K +++ + K S LKK H +++ K+K N P+ K + T R+ + + V+ Sbjct: 99 KNKKAASDKNGDKKTSTSLKKTQH----ARSTKMKKQNNPSSKTKPTKRQSEPNDSSVK 153 >SB_19981| Best HMM Match : E1-E2_ATPase (HMM E-Value=2.3) Length = 356 Score = 29.1 bits (62), Expect = 7.3 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 139 EPTPSTSNKRSYGKAFDNKSACKEKKVYKPVNINKEIMYRPSSP 182 EP STS +R YG A +K A E+ ++P ++ R ++P Sbjct: 3 EPQGSTSGQRPYGSAEPDKQAA-EQTAHEPARTPSPLVERITTP 45 >SB_12781| Best HMM Match : Spindle_assoc (HMM E-Value=0.12) Length = 200 Score = 29.1 bits (62), Expect = 7.3 Identities = 21/101 (20%), Positives = 45/101 (44%), Gaps = 4/101 (3%) Query: 290 KKNKPIMDSNQLFDQILDQNDAPKITIDTKNSKVSANLDHAKIISEVLKKYSHLLKGSKN 349 ++N ++ NQ + Q D + ++ K ++V N+ I L+ LKGS+ Sbjct: 66 RENSGLVHQNQ---DLKIQRDQLRHKVEEKTNEVERNISKTAGIRSELENTKKALKGSEE 122 Query: 350 IKLKILNTPNKKKQSTVREQKNSQQKVERHDSNFTYETDVI 390 ++ L + ++ST+R + ++ R T E + + Sbjct: 123 -RVSSLQKTVEARESTIRTLECRVDELVRQKKKITEELECV 162 >SB_12106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 29.1 bits (62), Expect = 7.3 Identities = 35/137 (25%), Positives = 59/137 (43%), Gaps = 13/137 (9%) Query: 258 IECKKSVDNIFEDNYLESGILDENEMFQTTYLKKNKPIMDSNQLFDQILDQNDAPKITID 317 I ++ DN +DN I D+N+ K N D+N D + ND K D Sbjct: 34 ININENNDNTNDDN--NKHINDDNDN------KTNNNDKDTND--DNTNEDND--KNNND 81 Query: 318 TKNSKVSANLDHAKIISEVLKKYSHLLKGSKNIKLKILNTPNKKKQSTVREQKNSQQKVE 377 N+K + N + + I++ +K ++ K + + + N N K + ++KN + Sbjct: 82 DNNNKTNDNDTNDENINDDNEKNTND-KNNNDDSNENTNDDNDKNTNDDNDKKNDDKDKN 140 Query: 378 RHDSNFTYETDVIDSKH 394 +D TD ID KH Sbjct: 141 TNDDFDDNTTDDIDKKH 157 >SB_2628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 277 Score = 29.1 bits (62), Expect = 7.3 Identities = 15/49 (30%), Positives = 26/49 (53%) Query: 330 AKIISEVLKKYSHLLKGSKNIKLKILNTPNKKKQSTVREQKNSQQKVER 378 A II LK Y ++ K S+N+K+ ++ V+++ +QKV R Sbjct: 115 AIIIVAFLKIYGNVSKASRNLKINASGKTAQQSSRVVQKRTEFEQKVTR 163 >SB_34768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1190 Score = 29.1 bits (62), Expect = 7.3 Identities = 15/55 (27%), Positives = 26/55 (47%) Query: 243 NNSSSDSKHTTTLDIIECKKSVDNIFEDNYLESGILDENEMFQTTYLKKNKPIMD 297 ++S SDS H LD ++ EDN+ + L + E+ +++ K I D Sbjct: 781 HDSESDSDHGNDLDGDWNSSDIEKEIEDNFFDLDRLSDEEVVYSSFTDLGKEIED 835 >SB_22573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 29.1 bits (62), Expect = 7.3 Identities = 17/77 (22%), Positives = 37/77 (48%), Gaps = 4/77 (5%) Query: 251 HTTTLDIIECKKSVDNIFEDNYLESGILDENEMFQTTYLKKNK---PIMDSNQLFDQILD 307 +T + +I+ ++ + N ++ ++D N + + + N ++DSN + ++D Sbjct: 27 NTIKVSVIDNSTIKVSVIDSNTIKVSVIDSNTI-NVSVIDSNTIKVSVIDSNTINVSVID 85 Query: 308 QNDAPKITIDTKNSKVS 324 N ID+K KVS Sbjct: 86 NNTIKVSVIDSKTIKVS 102 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 29.1 bits (62), Expect = 7.3 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 6/75 (8%) Query: 120 KAHRASQNPQCYAPKHKSSEPTPSTSNKRSYGKAFDNKSACKEKKVYKPVNI----NKEI 175 K+ S+ + P SS P S KR + + S+ +E+ ++PV I N EI Sbjct: 174 KSGEKSEPNRSLEPGELSSSPVTSRRRKRQWRSGESSTSSEREESAHRPVKIKRKKNLEI 233 Query: 176 MYRPSSPYIQNKKNL 190 Y+ + Q+ +NL Sbjct: 234 SYKTTRS--QSPENL 246 >SB_2537| Best HMM Match : zf-C2HC5 (HMM E-Value=2.5e-28) Length = 523 Score = 29.1 bits (62), Expect = 7.3 Identities = 17/79 (21%), Positives = 39/79 (49%), Gaps = 5/79 (6%) Query: 295 IMDSNQLFDQILDQNDAPKIT---IDTKNSKVSANLDHAKIISEVLKKYSHLLKGSKNIK 351 +++ N FD D P + T+++K + ++ + + E+ K+ + G K K Sbjct: 294 VVEENSTFDMYGQDPDLPVLASGYYSTQSNKENVSIGNEQAFPELNLKF--ISSGGKQAK 351 Query: 352 LKILNTPNKKKQSTVREQK 370 K+L T N ++ V++++ Sbjct: 352 SKVLKTENNIRKLRVQDRE 370 >SB_39040| Best HMM Match : ChaB (HMM E-Value=4.2) Length = 401 Score = 28.7 bits (61), Expect = 9.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Query: 331 KIISEVLKKYSHLLKGSKNIKLKILNTPNKKKQSTVR 367 K + + LK+Y+HL +G K + T + K ST R Sbjct: 270 KRVRKTLKEYTHLARGDGKGKRRTTRTTTRSKTSTKR 306 >SB_28946| Best HMM Match : Occludin_ELL (HMM E-Value=0.27) Length = 396 Score = 28.7 bits (61), Expect = 9.7 Identities = 25/120 (20%), Positives = 43/120 (35%), Gaps = 2/120 (1%) Query: 117 KLLKAHRASQNPQCYAPKHKSSEPTPSTSNKRSYGKAFDNKSACKEKKVYKPVNINKEI- 175 K + +SQ K EP P+ NKR A K++++ VN N + Sbjct: 232 KPTEGESSSQPSSAKTSPSKKQEP-PALGNKRQSSSISYASPANKKQRIAHVVNTNNNVS 290 Query: 176 MYRPSSPYIQNKKNLMTDPKPTRYELSEEFDGDGVFDSSFCNISYTSQPLMVHPDTKKRY 235 P + + N K T+ ++ +E D + + + D KK+Y Sbjct: 291 KENPEAHSVNNTKRHYDTSPSTKEQVKDENKAVNFRDKKPVSSTKNGEGKTAEMDYKKQY 350 >SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) Length = 1178 Score = 28.7 bits (61), Expect = 9.7 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 139 EPTPSTSNKRSYGKAFDNKSACKEKKVYKPVNINKEIMYRPSSP 182 EP STS +R YG A +K A E+ ++P + R +SP Sbjct: 577 EPQGSTSAQRPYGSAEPDKQAA-EQAAHEPARTPSALAERITSP 619 >SB_40159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1497 Score = 28.7 bits (61), Expect = 9.7 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Query: 347 SKNI-KLKILNTPNKKKQSTVREQKNSQQKVERHDSNFTYETDVIDSKH 394 ++NI K+K L P+KK +S VR+ N+ +V S T + + +D +H Sbjct: 23 TRNINKIKEL-LPDKKNKSKVRQFANNLDEVRGKASELTADLEELDPEH 70 >SB_28327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 576 Score = 28.7 bits (61), Expect = 9.7 Identities = 16/60 (26%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Query: 295 IMDSNQLFDQILDQNDAPKITIDTKNSKVSANLDHAKIISEVLKKYSHLLKGSKNIKLKI 354 I++S +F++ L + T+D ++++ S +L +K++ EV+ K L G + + L I Sbjct: 498 ILESKPVFEEGLYSSFLQ--TLDNQSARFSKSLKFSKMLLEVINKNKQLAAGHRQLLLGI 555 >SB_23539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1041 Score = 28.7 bits (61), Expect = 9.7 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 6/87 (6%) Query: 315 TIDTKNSKVSANLDHAKIISEVLKKYSHLLKGSKNIKLKILNTPNKKKQSTVREQKNS-- 372 T+ K ++ + H K K L K + N K T KKK+ KN+ Sbjct: 111 TLGKKKTRQTLGKKHDK---HSAKTRQTLGKNTTNTWQKTRQTIGKKKKHDKHSAKNTTN 167 Query: 373 -QQKVERHDSNFTYETDVIDSKHAAKL 398 +QK ++H + T T KH+AK+ Sbjct: 168 TRQKHDKHSAKNTTNTRQKHDKHSAKI 194 >SB_22230| Best HMM Match : CARD (HMM E-Value=3.8e-17) Length = 555 Score = 28.7 bits (61), Expect = 9.7 Identities = 18/74 (24%), Positives = 36/74 (48%), Gaps = 6/74 (8%) Query: 273 LESGILDENEMFQTTYLKKNKPIMDSNQLFDQILD------QNDAPKITIDTKNSKVSAN 326 + G+LD +E Q +++ M +L ILD +++ K+T+D S +SA+ Sbjct: 312 ISEGLLDNDETIQELLRERDSLEMKCKELEQVILDNESTETKSECHKVTLDRATSPLSAD 371 Query: 327 LDHAKIISEVLKKY 340 L+ + + K + Sbjct: 372 LERIEGVFNYKKDF 385 >SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) Length = 1452 Score = 28.7 bits (61), Expect = 9.7 Identities = 20/91 (21%), Positives = 37/91 (40%) Query: 288 YLKKNKPIMDSNQLFDQILDQNDAPKITIDTKNSKVSANLDHAKIISEVLKKYSHLLKGS 347 YLK + ++D + + Q+ T T N+ A + + + L+ S Sbjct: 578 YLKTLRSLVDPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRMREILMTAS 637 Query: 348 KNIKLKILNTPNKKKQSTVREQKNSQQKVER 378 NIK ++ P + ++ K QQK+ R Sbjct: 638 ANIKTPTMDMPLLAGKKVIKRAKKLQQKLNR 668 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.132 0.383 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,084,767 Number of Sequences: 59808 Number of extensions: 666335 Number of successful extensions: 2137 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 51 Number of HSP's that attempted gapping in prelim test: 2083 Number of HSP's gapped (non-prelim): 87 length of query: 433 length of database: 16,821,457 effective HSP length: 84 effective length of query: 349 effective length of database: 11,797,585 effective search space: 4117357165 effective search space used: 4117357165 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -