BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001574-TA|BGIBMGA001574-PA|undefined (57 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0364 + 33392181-33392487,33392919-33392994,33393671-333937... 25 5.9 08_02_0270 + 15108178-15108587,15108678-15108774,15109445-151094... 25 7.8 03_02_0178 + 6195402-6199158,6199438-6200003 25 7.8 >03_06_0364 + 33392181-33392487,33392919-33392994,33393671-33393740, 33394291-33394320,33394724-33394867,33394954-33395058, 33395496-33395642,33396994-33397069,33397726-33397814, 33398178-33398269,33398351-33398390,33398475-33398531 Length = 410 Score = 25.4 bits (53), Expect = 5.9 Identities = 10/20 (50%), Positives = 15/20 (75%) Query: 36 DRNSEKAEKCLREVIVCALS 55 + NSEKA +CL +++ ALS Sbjct: 249 EENSEKAVQCLNDMVTNALS 268 >08_02_0270 + 15108178-15108587,15108678-15108774,15109445-15109492, 15109583-15109806,15111367-15111463,15111556-15111651, 15112297-15112544,15112632-15112715,15112787-15113236, 15114880-15115024,15115116-15115217,15115677-15115769, 15117308-15117349,15119085-15119113,15119210-15119251, 15119922-15119997,15120764-15120835,15121208-15121326, 15121428-15121491,15121576-15123009 Length = 1323 Score = 25.0 bits (52), Expect = 7.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Query: 7 IKDRQNKTKHIPTHTHNSVEAAEAFKKTKDR 37 + D ++ +P HNS++A E ++DR Sbjct: 972 VHDERDAHSDLPMSRHNSMKAKEVSNSSRDR 1002 >03_02_0178 + 6195402-6199158,6199438-6200003 Length = 1440 Score = 25.0 bits (52), Expect = 7.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 25 VEAAEAFKKTKDRNSEKAEKCLREVI 50 V EA KK D NSE ++C R ++ Sbjct: 1027 VALQEALKKRSDLNSEMLQRCPRVLL 1052 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.315 0.124 0.345 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,274,222 Number of Sequences: 37544 Number of extensions: 29768 Number of successful extensions: 110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 107 Number of HSP's gapped (non-prelim): 3 length of query: 57 length of database: 14,793,348 effective HSP length: 37 effective length of query: 20 effective length of database: 13,404,220 effective search space: 268084400 effective search space used: 268084400 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -