BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001570-TA|BGIBMGA001570-PA|IPR000842|Phosphoribosyl pyrophosphate synthetase, IPR005946|Ribose-phosphate pyrophosphokinase, IPR000836|Phosphoribosyltransferase (318 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 23 2.2 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 22 5.2 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 6.8 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 23.4 bits (48), Expect = 2.2 Identities = 17/51 (33%), Positives = 21/51 (41%) Query: 208 VGDVKNKTAIMVDDLADTCDTILKGAEALREAGANKIYAFLTHGIFAGNAI 258 +G N T M+D+ D EAL+E N G AGNAI Sbjct: 61 LGVYPNGTLQMIDEWGDIEKGNFAEVEALKEINPNLKTIISIGGWNAGNAI 111 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 22.2 bits (45), Expect = 5.2 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Query: 129 LHASQIQGFFNIPVDNLYAEPAITKWIKENIPEWKSSVMVS 169 L+AS + G + DNL A +IT WI K ++ ++ Sbjct: 217 LYASPLDGEWQR--DNLNANSSITHWILSGADPQKLAIGIA 255 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.8 bits (44), Expect = 6.8 Identities = 15/55 (27%), Positives = 25/55 (45%) Query: 206 VLVGDVKNKTAIMVDDLADTCDTILKGAEALREAGANKIYAFLTHGIFAGNAIEK 260 VL +V+ +DDL +T+ + E LR+ A +T + N I+K Sbjct: 445 VLGTEVREFVVNYIDDLLVASETLNEHLEHLRQVFEKLKQARMTINLEKSNFIQK 499 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,542 Number of Sequences: 317 Number of extensions: 2512 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 3 length of query: 318 length of database: 114,650 effective HSP length: 57 effective length of query: 261 effective length of database: 96,581 effective search space: 25207641 effective search space used: 25207641 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -