BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001570-TA|BGIBMGA001570-PA|IPR000842|Phosphoribosyl
pyrophosphate synthetase, IPR005946|Ribose-phosphate
pyrophosphokinase, IPR000836|Phosphoribosyltransferase
(318 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 8.6
>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
Length = 3398
Score = 23.4 bits (48), Expect = 8.6
Identities = 9/37 (24%), Positives = 18/37 (48%)
Query: 245 YAFLTHGIFAGNAIEKINNSSLEAIVVTNTIPQEKNM 281
+ + +HG A+ + S IV TN +P+ ++
Sbjct: 1975 FTYSSHGKVMREALVNLTRESCYQIVKTNEVPESTDL 2011
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.318 0.133 0.377
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 283,579
Number of Sequences: 2123
Number of extensions: 10185
Number of successful extensions: 17
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 16
Number of HSP's gapped (non-prelim): 1
length of query: 318
length of database: 516,269
effective HSP length: 64
effective length of query: 254
effective length of database: 380,397
effective search space: 96620838
effective search space used: 96620838
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 48 (23.4 bits)
- SilkBase 1999-2023 -