BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001570-TA|BGIBMGA001570-PA|IPR000842|Phosphoribosyl pyrophosphate synthetase, IPR005946|Ribose-phosphate pyrophosphokinase, IPR000836|Phosphoribosyltransferase (318 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 8.6 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 8.6 Identities = 9/37 (24%), Positives = 18/37 (48%) Query: 245 YAFLTHGIFAGNAIEKINNSSLEAIVVTNTIPQEKNM 281 + + +HG A+ + S IV TN +P+ ++ Sbjct: 1975 FTYSSHGKVMREALVNLTRESCYQIVKTNEVPESTDL 2011 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 283,579 Number of Sequences: 2123 Number of extensions: 10185 Number of successful extensions: 17 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 1 length of query: 318 length of database: 516,269 effective HSP length: 64 effective length of query: 254 effective length of database: 380,397 effective search space: 96620838 effective search space used: 96620838 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -