SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001570-TA|BGIBMGA001570-PA|IPR000842|Phosphoribosyl
pyrophosphate synthetase, IPR005946|Ribose-phosphate
pyrophosphokinase, IPR000836|Phosphoribosyltransferase
         (318 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   8.6  

>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.4 bits (48), Expect = 8.6
 Identities = 9/37 (24%), Positives = 18/37 (48%)

Query: 245  YAFLTHGIFAGNAIEKINNSSLEAIVVTNTIPQEKNM 281
            + + +HG     A+  +   S   IV TN +P+  ++
Sbjct: 1975 FTYSSHGKVMREALVNLTRESCYQIVKTNEVPESTDL 2011


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.318    0.133    0.377 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 283,579
Number of Sequences: 2123
Number of extensions: 10185
Number of successful extensions: 17
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 16
Number of HSP's gapped (non-prelim): 1
length of query: 318
length of database: 516,269
effective HSP length: 64
effective length of query: 254
effective length of database: 380,397
effective search space: 96620838
effective search space used: 96620838
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 48 (23.4 bits)

- SilkBase 1999-2023 -