BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001570-TA|BGIBMGA001570-PA|IPR000842|Phosphoribosyl pyrophosphate synthetase, IPR005946|Ribose-phosphate pyrophosphokinase, IPR000836|Phosphoribosyltransferase (318 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 6.1 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 22.2 bits (45), Expect = 6.1 Identities = 13/87 (14%), Positives = 40/87 (45%), Gaps = 1/87 (1%) Query: 107 ITAKLLANLISVAGADHVITIDLHASQIQGFFNIPVDNLYAEPAITKWIKENIPEWKSSV 166 + ++ AN + G ++++ A I + L + ++ W + + + ++ Sbjct: 282 VKSQYQANNVHYQGKENILWTQASAKGISDN-GVLFFGLVGDTSLACWNENRLLDRRNIE 340 Query: 167 MVSPDAGGVKRMTGIADRLDIDFAIIH 193 +V+ + ++ +TG+ + I F ++H Sbjct: 341 VVAKNKETLQAITGLKVKRRISFILVH 367 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,767 Number of Sequences: 429 Number of extensions: 3062 Number of successful extensions: 6 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 1 length of query: 318 length of database: 140,377 effective HSP length: 58 effective length of query: 260 effective length of database: 115,495 effective search space: 30028700 effective search space used: 30028700 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -