BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001569-TA|BGIBMGA001569-PA|IPR000322|Glycoside
hydrolase, family 31
(509 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. 25 6.3
>CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein.
Length = 376
Score = 24.6 bits (51), Expect = 6.3
Identities = 11/46 (23%), Positives = 22/46 (47%)
Query: 306 VPNLQPSQSHVHVWLPSESWYELWSGLKIEGNVGDAVTMTTTESDF 351
+ +L PS + + P E Y +W G I ++ TM ++ ++
Sbjct: 318 ITSLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQTMWISKHEY 363
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.319 0.135 0.414
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 480,715
Number of Sequences: 2123
Number of extensions: 19833
Number of successful extensions: 80
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 79
Number of HSP's gapped (non-prelim): 1
length of query: 509
length of database: 516,269
effective HSP length: 67
effective length of query: 442
effective length of database: 374,028
effective search space: 165320376
effective search space used: 165320376
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 50 (24.2 bits)
- SilkBase 1999-2023 -