BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001569-TA|BGIBMGA001569-PA|IPR000322|Glycoside hydrolase, family 31 (509 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. 25 6.3 >CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. Length = 376 Score = 24.6 bits (51), Expect = 6.3 Identities = 11/46 (23%), Positives = 22/46 (47%) Query: 306 VPNLQPSQSHVHVWLPSESWYELWSGLKIEGNVGDAVTMTTTESDF 351 + +L PS + + P E Y +W G I ++ TM ++ ++ Sbjct: 318 ITSLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQTMWISKHEY 363 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.135 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 480,715 Number of Sequences: 2123 Number of extensions: 19833 Number of successful extensions: 80 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 79 Number of HSP's gapped (non-prelim): 1 length of query: 509 length of database: 516,269 effective HSP length: 67 effective length of query: 442 effective length of database: 374,028 effective search space: 165320376 effective search space used: 165320376 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -