BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001568-TA|BGIBMGA001568-PA|IPR000519|P-type trefoil, IPR000322|Glycoside hydrolase, family 31 (337 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 3.0 EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhy... 24 5.3 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 25.0 bits (52), Expect = 3.0 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 101 HCCYDFRSKTCFHRFPSRFSYVMDRVWDEDVVLSAR 136 HCC DF + C P + + D+ W +VV +R Sbjct: 745 HCC-DFYACDCKMECPKQCTCYHDQSWSSNVVDCSR 779 >EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhydrase protein. Length = 255 Score = 24.2 bits (50), Expect = 5.3 Identities = 9/32 (28%), Positives = 19/32 (59%) Query: 175 IPHGNRLEEKNYFYDVASPELNVVVNSTERMI 206 +PH +++ + + A+ EL VVN+ + +I Sbjct: 67 VPHAEHFQDEYFSCEPAALELGCVVNNIKHII 98 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.323 0.139 0.436 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 348,446 Number of Sequences: 2123 Number of extensions: 13731 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 19 Number of HSP's gapped (non-prelim): 2 length of query: 337 length of database: 516,269 effective HSP length: 64 effective length of query: 273 effective length of database: 380,397 effective search space: 103848381 effective search space used: 103848381 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -