GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001567-TA|BGIBMGA001567-PA|undefined
         (90 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory recept...    22   1.2  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    19   8.2  

>AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory receptor
           candidate 60 protein.
          Length = 364

 Score = 21.8 bits (44), Expect = 1.2
 Identities = 12/35 (34%), Positives = 16/35 (45%)

Query: 14  FVARCALSLALQALNGTPQRESSSLTDLISAFDTK 48
           F  RC LSL   A+ G+    S   T   +  +TK
Sbjct: 325 FWVRCVLSLHCAAVGGSANIMSGCSTSTSTNINTK 359


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 19.0 bits (37), Expect = 8.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)

Query: 30  TPQRESSSLTDL 41
           +PQ+ S S+TDL
Sbjct: 698 SPQQRSPSVTDL 709


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.319    0.130    0.367 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,559
Number of Sequences: 317
Number of extensions: 547
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of query: 90
length of database: 114,650
effective HSP length: 47
effective length of query: 43
effective length of database: 99,751
effective search space:  4289293
effective search space used:  4289293
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (19.9 bits)
S2: 37 (19.0 bits)