BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001566-TA|BGIBMGA001566-PA|IPR002219|Protein kinase C, phorbol ester/diacylglycerol binding, IPR000008|C2 calcium-dependent membrane targeting, IPR008973|C2 calcium/lipid-binding region, CaLB (1958 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 27 1.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 27 1.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 27 1.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 27 1.3 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 26 2.9 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 25 3.9 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 27.1 bits (57), Expect = 1.3 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 620 YENKNVKIDYNLRSNEQLLKNVCSSRDLQKFQDKIESDYYKSEMH 664 +ENK +++ L+S +L ++ + R QK+ ++ DYY+ E H Sbjct: 571 HENKEEMMEF-LKSILRLDEDQSARRVAQKYLRVVDPDYYEFETH 614 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 27.1 bits (57), Expect = 1.3 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 620 YENKNVKIDYNLRSNEQLLKNVCSSRDLQKFQDKIESDYYKSEMH 664 +ENK +++ L+S +L ++ + R QK+ ++ DYY+ E H Sbjct: 571 HENKEEMMEF-LKSILRLDEDQSARRVAQKYLRVVDPDYYEFETH 614 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 27.1 bits (57), Expect = 1.3 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 620 YENKNVKIDYNLRSNEQLLKNVCSSRDLQKFQDKIESDYYKSEMH 664 +ENK +++ L+S +L ++ + R QK+ ++ DYY+ E H Sbjct: 571 HENKEEMMEF-LKSILRLDEDQSARRVAQKYLRVVDPDYYEFETH 614 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 27.1 bits (57), Expect = 1.3 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 620 YENKNVKIDYNLRSNEQLLKNVCSSRDLQKFQDKIESDYYKSEMH 664 +ENK +++ L+S +L ++ + R QK+ ++ DYY+ E H Sbjct: 571 HENKEEMMEF-LKSILRLDEDQSARRVAQKYLRVVDPDYYEFETH 614 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 25.8 bits (54), Expect = 2.9 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Query: 1378 SPMKETWKDITTFPSIEESVDSTKDHDQESDDDKSYADTGSGE-TSGPD 1425 SP+ T + I++ + D D + DDD S ++ + TS PD Sbjct: 264 SPLGHTLSMNHKYEKIDKEEHESMDDDDDDDDDMSNSENQNPRFTSSPD 312 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 25.4 bits (53), Expect = 3.9 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 611 LETLVDSYMYENKNVKIDYNLRSNEQLLKNVCSSRDLQKFQDKIESDYYKS 661 L+ LVD M E ++ID N R N+ + + ++ K Q + ESD S Sbjct: 321 LDVLVD--MCEQDIIRIDRNTRFNQDKIVALRQEQETLKSQVQRESDVVDS 369 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.311 0.128 0.366 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 407,428 Number of Sequences: 317 Number of extensions: 17139 Number of successful extensions: 33 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 27 Number of HSP's gapped (non-prelim): 12 length of query: 1958 length of database: 114,650 effective HSP length: 67 effective length of query: 1891 effective length of database: 93,411 effective search space: 176640201 effective search space used: 176640201 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -