BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001563-TA|BGIBMGA001563-PA|undefined (150 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 25 0.28 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 20 7.9 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 25.0 bits (52), Expect = 0.28 Identities = 18/66 (27%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Query: 58 TSRENSYERDEYHTH-GDTDPLYYNSQPRTNRMDTWSQLHAQASMESAISWRTAADWQSG 116 TS N Y ++ T+ G P Y NSQ N M + + M + AA Sbjct: 295 TSSHNYYAQNYAPTYYGQMQPDYLNSQTTQNHMQAMNNMAGTYQMTGYSAMGMAAPHHQN 354 Query: 117 EEQRRP 122 R P Sbjct: 355 FGPRHP 360 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 20.2 bits (40), Expect = 7.9 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 72 HGDTDPLYYNSQPRTNRMDTWS 93 H PL++++ PRT +T S Sbjct: 111 HPYLSPLFHSAAPRTASRETKS 132 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.310 0.124 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,173 Number of Sequences: 317 Number of extensions: 1512 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 150 length of database: 114,650 effective HSP length: 52 effective length of query: 98 effective length of database: 98,166 effective search space: 9620268 effective search space used: 9620268 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (20.9 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -