BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001563-TA|BGIBMGA001563-PA|undefined
(150 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 5.5
>DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein.
Length = 847
Score = 22.6 bits (46), Expect = 5.5
Identities = 13/49 (26%), Positives = 23/49 (46%)
Query: 102 ESAISWRTAADWQSGEEQRRPSLERQSTLYDDGLGYGYESYTTTGAHIG 150
++A + +A +S +E+R P + +S LG G G H+G
Sbjct: 114 KAAAANSSATSSESEDERRTPPQDMRSMAGFRSLGSGAPPKAQGGKHVG 162
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.310 0.124 0.371
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 173,659
Number of Sequences: 2123
Number of extensions: 6440
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 150
length of database: 516,269
effective HSP length: 59
effective length of query: 91
effective length of database: 391,012
effective search space: 35582092
effective search space used: 35582092
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 44 (21.8 bits)
- SilkBase 1999-2023 -