BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001563-TA|BGIBMGA001563-PA|undefined (150 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 5.5 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 22.6 bits (46), Expect = 5.5 Identities = 13/49 (26%), Positives = 23/49 (46%) Query: 102 ESAISWRTAADWQSGEEQRRPSLERQSTLYDDGLGYGYESYTTTGAHIG 150 ++A + +A +S +E+R P + +S LG G G H+G Sbjct: 114 KAAAANSSATSSESEDERRTPPQDMRSMAGFRSLGSGAPPKAQGGKHVG 162 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.310 0.124 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,659 Number of Sequences: 2123 Number of extensions: 6440 Number of successful extensions: 6 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 1 length of query: 150 length of database: 516,269 effective HSP length: 59 effective length of query: 91 effective length of database: 391,012 effective search space: 35582092 effective search space used: 35582092 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -