GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001563-TA|BGIBMGA001563-PA|undefined
         (150 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.            23   5.5  

>DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.
          Length = 847

 Score = 22.6 bits (46), Expect = 5.5
 Identities = 13/49 (26%), Positives = 23/49 (46%)

Query: 102 ESAISWRTAADWQSGEEQRRPSLERQSTLYDDGLGYGYESYTTTGAHIG 150
           ++A +  +A   +S +E+R P  + +S      LG G       G H+G
Sbjct: 114 KAAAANSSATSSESEDERRTPPQDMRSMAGFRSLGSGAPPKAQGGKHVG 162


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.310    0.124    0.371 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 173,659
Number of Sequences: 2123
Number of extensions: 6440
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 150
length of database: 516,269
effective HSP length: 59
effective length of query: 91
effective length of database: 391,012
effective search space: 35582092
effective search space used: 35582092
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 44 (21.8 bits)