BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001559-TA|BGIBMGA001559-PA|IPR004148|BAR, IPR001452|Src homology-3, IPR013315|Spectrin alpha chain (843 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 25 2.6 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 25 2.6 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 25.0 bits (52), Expect = 2.6 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Query: 454 LQPNPTARAKMAAVKGISKLSGQAKSNTYPQPEGV 488 L+ P + + A+KG K+SG K Y EG+ Sbjct: 19 LEDAPRVKTPLGAIKGYYKISGNGKQ--YEAYEGI 51 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 25.0 bits (52), Expect = 2.6 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Query: 454 LQPNPTARAKMAAVKGISKLSGQAKSNTYPQPEGV 488 L+ P + + A+KG K+SG K Y EG+ Sbjct: 19 LEDAPRVKTPLGAIKGYYKISGNGKQ--YEAYEGI 51 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.135 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,047 Number of Sequences: 429 Number of extensions: 6732 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 2 length of query: 843 length of database: 140,377 effective HSP length: 64 effective length of query: 779 effective length of database: 112,921 effective search space: 87965459 effective search space used: 87965459 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -