BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001558-TA|BGIBMGA001558-PA|IPR002301|Isoleucyl-tRNA synthetase, class Ia, IPR002300|Aminoacyl-tRNA synthetase, class Ia, IPR013155|tRNA synthetase, valyl/leucyl, anticodon-binding, IPR001412|Aminoacyl-tRNA synthetase, class I, IPR009080|Aminoacyl-tRNA synthetase, class 1a, anticodon-binding (1212 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 27 1.2 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 27 1.2 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 27 1.2 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 25 4.9 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 24 6.5 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 26.6 bits (56), Expect = 1.2 Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 1084 FGVTSNQASIILKDNENKFISLNKLYDEVN 1113 FG SN+ +++ KD +S+NK +++ N Sbjct: 671 FGSWSNRPNLLFKDEAKDLVSVNKSWNKWN 700 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 26.6 bits (56), Expect = 1.2 Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 1084 FGVTSNQASIILKDNENKFISLNKLYDEVN 1113 FG SN+ +++ KD +S+NK +++ N Sbjct: 671 FGSWSNRPNLLFKDEAKDLVSVNKSWNKWN 700 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 26.6 bits (56), Expect = 1.2 Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 1084 FGVTSNQASIILKDNENKFISLNKLYDEVN 1113 FG SN+ +++ KD +S+NK +++ N Sbjct: 671 FGSWSNRPNLLFKDEAKDLVSVNKSWNKWN 700 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 24.6 bits (51), Expect = 4.9 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Query: 674 EDHVDYRFNEKAIRENVMDKWITSFTQSLIQFVKKEMAAYRLY 716 ED V+ + +++ E + + SFTQ LI+ + Y LY Sbjct: 195 EDDVEIKVQVESVIE--FEPGLDSFTQQLIEMKNAQARVYLLY 235 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 24.2 bits (50), Expect = 6.5 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 666 QNVERLVQEDHVDYRFNEKAIRENVMDKWI-TSFTQSL 702 QN + + + Y F + NV+DKWI T +SL Sbjct: 253 QNEVGFYEVEGIGYDFIPTVLDRNVIDKWIKTEDNESL 290 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.138 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 362,715 Number of Sequences: 429 Number of extensions: 16053 Number of successful extensions: 45 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 41 Number of HSP's gapped (non-prelim): 5 length of query: 1212 length of database: 140,377 effective HSP length: 66 effective length of query: 1146 effective length of database: 112,063 effective search space: 128424198 effective search space used: 128424198 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -