BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001556-TA|BGIBMGA001556-PA|IPR005919|Higher eukaryotic phosphomevalonate kinase (186 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36400.2 68417.m05172 FAD linked oxidase family protein low s... 27 5.8 At4g36400.1 68417.m05171 FAD linked oxidase family protein low s... 27 5.8 At3g49730.1 68416.m05437 pentatricopeptide (PPR) repeat-containi... 27 7.7 >At4g36400.2 68417.m05172 FAD linked oxidase family protein low similarity to SP|Q12627 from Kluyveromyces lactis and SP|P32891 from Saccharomyces cerevisiae; contains Pfam FAD linked oxidases, C-terminal domain PF02913, Pfam FAD binding domain PF01565 Length = 559 Score = 27.5 bits (58), Expect = 5.8 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Query: 58 SEGEYKEQYRLEMIKWSEEMRNKDYGCFCKAACENAAIKPVWIVSDIRRKTDIRWFKETY 117 S+G YK + I + M + Y CF +A P++ D + D+ +FKE Sbjct: 51 SDGNYKTELHHPCISRNVGMLLQQYKCFGSSAASLIQRNPLFSSLDSK---DVSYFKEIL 107 Query: 118 GD 119 G+ Sbjct: 108 GE 109 >At4g36400.1 68417.m05171 FAD linked oxidase family protein low similarity to SP|Q12627 from Kluyveromyces lactis and SP|P32891 from Saccharomyces cerevisiae; contains Pfam FAD linked oxidases, C-terminal domain PF02913, Pfam FAD binding domain PF01565 Length = 559 Score = 27.5 bits (58), Expect = 5.8 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Query: 58 SEGEYKEQYRLEMIKWSEEMRNKDYGCFCKAACENAAIKPVWIVSDIRRKTDIRWFKETY 117 S+G YK + I + M + Y CF +A P++ D + D+ +FKE Sbjct: 51 SDGNYKTELHHPCISRNVGMLLQQYKCFGSSAASLIQRNPLFSSLDSK---DVSYFKEIL 107 Query: 118 GD 119 G+ Sbjct: 108 GE 109 >At3g49730.1 68416.m05437 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 1184 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Query: 69 EMIKWSEEMRNKDYGCFCKAACENAAIKPV-WIVSDIRRK--TDIRWF 113 EM K+ E +GC A C+N ++K + D+R K ++R+F Sbjct: 192 EMPKYGLEPDEYVFGCLLDALCKNGSVKEASKVFEDMREKFPPNLRYF 239 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.320 0.136 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,927,905 Number of Sequences: 28952 Number of extensions: 136819 Number of successful extensions: 228 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 228 Number of HSP's gapped (non-prelim): 3 length of query: 186 length of database: 12,070,560 effective HSP length: 77 effective length of query: 109 effective length of database: 9,841,256 effective search space: 1072696904 effective search space used: 1072696904 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -