BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001553-TA|BGIBMGA001553-PA|IPR001757|ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter, IPR013200|HAD superfamily hydrolase-like, type 3 (564 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 28 0.57 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 25 7.1 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 28.3 bits (60), Expect = 0.57 Identities = 14/36 (38%), Positives = 16/36 (44%) Query: 114 YVSGGAHTSEPHEHANDDSNGFAIVVNGHSLVHCLH 149 Y SGG + H + S G VNG SL H H Sbjct: 464 YFSGGFSSLHSHHSPHHVSPGMGSTVNGASLTHSHH 499 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 24.6 bits (51), Expect = 7.1 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Query: 173 PLQKAMVVELIKKSRKAVTLAIGDGANDVSMIKAAHIGVGISGQE-GMQAVLASDYSI 229 PLQ+ + E+ ++ LA G GA D + GI+ E G +A A++ + Sbjct: 311 PLQQVGIREIFSQNASLPLLARGRGARDEVRVSRIFQKAGITINELGSEAYAATEIQL 368 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.325 0.137 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 542,795 Number of Sequences: 2123 Number of extensions: 20767 Number of successful extensions: 102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 101 Number of HSP's gapped (non-prelim): 2 length of query: 564 length of database: 516,269 effective HSP length: 68 effective length of query: 496 effective length of database: 371,905 effective search space: 184464880 effective search space used: 184464880 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -