BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001552-TA|BGIBMGA001552-PA|IPR006539|Phospholipid- translocating P-type ATPase, flippase, IPR001757|ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter (637 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 27 0.39 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 24 3.7 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 27.1 bits (57), Expect = 0.39 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 325 TVVPISLYVSVEVIRFAQSFLINWDEKMYYE 355 TV+PI ++ S E I F + F ++ M+YE Sbjct: 287 TVIPIHVWTSKEKISFLRGFWLSPAVDMFYE 317 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 23.8 bits (49), Expect = 3.7 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 17 IKTSKYSIITFLPLNLLEQFQRLANFYFLCLLVL 50 ++T K S+ FL + +E FQ +F++ LL L Sbjct: 137 VQTEK-SVFDFLCRHTVEYFQNYIHFFYQLLLYL 169 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.138 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,391 Number of Sequences: 317 Number of extensions: 5978 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 2 length of query: 637 length of database: 114,650 effective HSP length: 61 effective length of query: 576 effective length of database: 95,313 effective search space: 54900288 effective search space used: 54900288 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -