BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001546-TA|BGIBMGA001546-PA|IPR013594|Dynein heavy chain, N-terminal region 1, IPR013602|Dynein heavy chain, N-terminal region 2, IPR011704|ATPase associated with various cellular activities, AAA-5, IPR003593|AAA ATPase (3072 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 26 3.5 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 25 6.1 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 26.2 bits (55), Expect = 3.5 Identities = 27/111 (24%), Positives = 49/111 (44%), Gaps = 7/111 (6%) Query: 1058 RTLEFLTEWERNKPTDGSTRPEDALSRL-QAMETRYTRLKDERDNVAKAKEALELHDTGS 1116 + L ++T W + +P G PED L + + LKD + A K+ E++D Sbjct: 523 QVLCYITSWSQKRPGAGKFTPEDINPSLCTHIIYAFATLKDHKLAEASDKDP-EMYDRVV 581 Query: 1117 SINNERMTVVLEELQDLRGVWQQLEAMLNELKELPARLR--MYDSYEFVRK 1165 ++ + L+ L + G W EL R+ +YD+ +F+R+ Sbjct: 582 ALREKNPD--LKILLAIGG-WAFGSTPFKELTSNVFRMNQFVYDAIDFLRE 629 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 25.4 bits (53), Expect = 6.1 Identities = 14/56 (25%), Positives = 28/56 (50%) Query: 781 PSLEEARFQLMRQMFAWQAIVTSLHRLQSTRYQVGVARAQTATYRNLLTKLPGGSA 836 P+ ++ + ++ + A + TS++ STR+ A A+ +L+ K G SA Sbjct: 260 PASTQSLSRWIKMVLAESGVDTSIYTAHSTRHAATSAAARKGISLDLIRKTAGWSA 315 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 671,219 Number of Sequences: 317 Number of extensions: 28148 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 58 Number of HSP's gapped (non-prelim): 3 length of query: 3072 length of database: 114,650 effective HSP length: 70 effective length of query: 3002 effective length of database: 92,460 effective search space: 277564920 effective search space used: 277564920 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -