BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001545-TA|BGIBMGA001545-PA|IPR007110|Immunoglobulin-like (187 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g49540.1 68414.m05553 transducin family protein / WD-40 repea... 28 3.4 At3g17680.1 68416.m02257 expressed protein similar to GB:AAD4975... 28 4.5 At5g52090.1 68418.m06466 tRNA-splicing endonuclease positive eff... 27 7.8 >At1g49540.1 68414.m05553 transducin family protein / WD-40 repeat family protein similar to signal transducer and activator of transcription interacting protein 1 (GI:15929722) {Mus musculus}; similar to hypothetical protein GB:AAD43147 GI:5430747 from (Arabidopsis thaliana); contains Pfam PF00400: WD domain, G-beta repeat (11 copies, 2 weak) Length = 840 Score = 28.3 bits (60), Expect = 3.4 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 6/67 (8%) Query: 21 SDARFAALHADGS-DEWTLRVSPAQPRDSGAYECQVSTEPKISLSFRLTVVVSKAEILSG 79 +DA FA+ +DG + W + P+QP + EC+V I + + V +S AE+ Sbjct: 133 TDAMFASASSDGVVNVWDVSF-PSQPSE----ECKVVCLDSICVDTKAIVTLSLAELPQN 187 Query: 80 PELFVRA 86 P F A Sbjct: 188 PGRFALA 194 >At3g17680.1 68416.m02257 expressed protein similar to GB:AAD49756 from [Arabidopsis thaliana] Length = 313 Score = 27.9 bits (59), Expect = 4.5 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Query: 52 ECQVSTEPKISLSFRLTVVVSKAEILSGPELFVRAGSDINLTCVAKHAPDPPRGKIRILQ 111 E +V+ E +L ++LT ++ + L+ LF++ + CV K D K+ ILQ Sbjct: 176 EKEVAVEENANLGYKLTSLLEENRELATEALFMKNEAVGLARCVLKMRDDHFH-KVCILQ 234 Query: 112 NVIEFSDSFRKNENSITKV 130 N I + R +E KV Sbjct: 235 NRIYSLQASRNSEPVSDKV 253 >At5g52090.1 68418.m06466 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 676 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/36 (30%), Positives = 22/36 (61%) Query: 109 ILQNVIEFSDSFRKNENSITKVIKDDIFQLYLLVPR 144 ++ N+ F + +KN NS+++ +K I LY +P+ Sbjct: 227 VVVNIPTFGEFVQKNFNSLSEEVKTCIVDLYTHLPK 262 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.320 0.134 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,570,830 Number of Sequences: 28952 Number of extensions: 177144 Number of successful extensions: 336 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 335 Number of HSP's gapped (non-prelim): 3 length of query: 187 length of database: 12,070,560 effective HSP length: 77 effective length of query: 110 effective length of database: 9,841,256 effective search space: 1082538160 effective search space used: 1082538160 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -