SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001544-TA|BGIBMGA001544-PA|undefined
         (214 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_03_0259 - 11161447-11161706,11161764-11164266                       28   5.0  

>05_03_0259 - 11161447-11161706,11161764-11164266
          Length = 920

 Score = 28.3 bits (60), Expect = 5.0
 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 3/64 (4%)

Query: 92  KNKELLKTLNRKMMMICEAHEEQT--LMDEMYRI-VKINVVAYCVAVYGSVTFFVFEGLR 148
           K  +  +    K  M+ E + E+   L+D+M    V  N + YC  ++G +     E + 
Sbjct: 817 KEGKTTEAFKLKQKMVEEGYMEEAIKLLDQMIENNVDPNYITYCTLIHGYIKSGNMEEIS 876

Query: 149 KFYD 152
           K YD
Sbjct: 877 KLYD 880


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.327    0.140    0.409 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,337,872
Number of Sequences: 37544
Number of extensions: 191382
Number of successful extensions: 527
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 527
Number of HSP's gapped (non-prelim): 1
length of query: 214
length of database: 14,793,348
effective HSP length: 79
effective length of query: 135
effective length of database: 11,827,372
effective search space: 1596695220
effective search space used: 1596695220
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 58 (27.5 bits)

- SilkBase 1999-2023 -