BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001544-TA|BGIBMGA001544-PA|undefined
(214 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
05_03_0259 - 11161447-11161706,11161764-11164266 28 5.0
>05_03_0259 - 11161447-11161706,11161764-11164266
Length = 920
Score = 28.3 bits (60), Expect = 5.0
Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 3/64 (4%)
Query: 92 KNKELLKTLNRKMMMICEAHEEQT--LMDEMYRI-VKINVVAYCVAVYGSVTFFVFEGLR 148
K + + K M+ E + E+ L+D+M V N + YC ++G + E +
Sbjct: 817 KEGKTTEAFKLKQKMVEEGYMEEAIKLLDQMIENNVDPNYITYCTLIHGYIKSGNMEEIS 876
Query: 149 KFYD 152
K YD
Sbjct: 877 KLYD 880
Database: rice
Posted date: Oct 3, 2007 3:31 PM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.327 0.140 0.409
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,337,872
Number of Sequences: 37544
Number of extensions: 191382
Number of successful extensions: 527
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 527
Number of HSP's gapped (non-prelim): 1
length of query: 214
length of database: 14,793,348
effective HSP length: 79
effective length of query: 135
effective length of database: 11,827,372
effective search space: 1596695220
effective search space used: 1596695220
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 58 (27.5 bits)
- SilkBase 1999-2023 -