BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001544-TA|BGIBMGA001544-PA|undefined (214 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0259 - 11161447-11161706,11161764-11164266 28 5.0 >05_03_0259 - 11161447-11161706,11161764-11164266 Length = 920 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Query: 92 KNKELLKTLNRKMMMICEAHEEQT--LMDEMYRI-VKINVVAYCVAVYGSVTFFVFEGLR 148 K + + K M+ E + E+ L+D+M V N + YC ++G + E + Sbjct: 817 KEGKTTEAFKLKQKMVEEGYMEEAIKLLDQMIENNVDPNYITYCTLIHGYIKSGNMEEIS 876 Query: 149 KFYD 152 K YD Sbjct: 877 KLYD 880 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.327 0.140 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,337,872 Number of Sequences: 37544 Number of extensions: 191382 Number of successful extensions: 527 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 527 Number of HSP's gapped (non-prelim): 1 length of query: 214 length of database: 14,793,348 effective HSP length: 79 effective length of query: 135 effective length of database: 11,827,372 effective search space: 1596695220 effective search space used: 1596695220 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -