BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001544-TA|BGIBMGA001544-PA|undefined (214 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070256-1|AAL59655.1| 227|Anopheles gambiae glutathione S-tran... 25 1.7 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 6.9 >AY070256-1|AAL59655.1| 227|Anopheles gambiae glutathione S-transferase E6 protein. Length = 227 Score = 25.0 bits (52), Expect = 1.7 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 175 FKRLRENVDELVAAGKARLAAEKLAQGLVEGIKMHNELLR 214 F RLR D L GK+ + E L + L EG++ +L+ Sbjct: 109 FARLRFCTDNLTVLGKSAIPEENLQRAL-EGLQRLERMLQ 147 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 6.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Query: 147 LRKFYDVDTYTMAYLIMYKYKFITLR 172 L+K Y ++T +Y I Y+Y+ LR Sbjct: 2044 LKKVYVINTLNTSYSIDYEYENDNLR 2069 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.327 0.140 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,727 Number of Sequences: 2123 Number of extensions: 7723 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 3 length of query: 214 length of database: 516,269 effective HSP length: 61 effective length of query: 153 effective length of database: 386,766 effective search space: 59175198 effective search space used: 59175198 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -