BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001544-TA|BGIBMGA001544-PA|undefined (214 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 24 1.2 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 5.0 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 23.8 bits (49), Expect = 1.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 53 TVLEIMAATMGDFPDDEK 70 T+ ++ A G+FP+DEK Sbjct: 50 TIEDVEATEYGEFPEDEK 67 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/38 (26%), Positives = 19/38 (50%) Query: 90 IIKNKELLKTLNRKMMMICEAHEEQTLMDEMYRIVKIN 127 + +N+E L+T+ MM + M M R+ ++N Sbjct: 345 VAQNEETLQTVVAMKMMHLPQSNKMNRMHRMNRVNRVN 382 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.327 0.140 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,684 Number of Sequences: 429 Number of extensions: 2274 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 214 length of database: 140,377 effective HSP length: 55 effective length of query: 159 effective length of database: 116,782 effective search space: 18568338 effective search space used: 18568338 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -