SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001543-TA|BGIBMGA001543-PA|undefined
         (110 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g43880.1 68418.m05366 expressed protein                             27   2.1  

>At5g43880.1 68418.m05366 expressed protein
          Length = 836

 Score = 27.5 bits (58), Expect = 2.1
 Identities = 15/53 (28%), Positives = 26/53 (49%)

Query: 1   MAAVGENLEEASIMRRQFRKMRLGTALYFISVYLSLVAYGVESARRTIVEGER 53
           MAA  ENL+EA ++ ++   + LG  L    +   L+    E++     EG +
Sbjct: 393 MAAANENLQEAKVIEKKGSNISLGDMLALPDLREDLITEEEETSNGNEQEGPK 445


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.326    0.138    0.370 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,668,297
Number of Sequences: 28952
Number of extensions: 41792
Number of successful extensions: 89
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 88
Number of HSP's gapped (non-prelim): 1
length of query: 110
length of database: 12,070,560
effective HSP length: 71
effective length of query: 39
effective length of database: 10,014,968
effective search space: 390583752
effective search space used: 390583752
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 53 (25.4 bits)

- SilkBase 1999-2023 -