BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001541-TA|BGIBMGA001541-PA|IPR013026|Tetratricopeptide region, IPR001440|Tetratricopeptide TPR_1 (154 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 25 0.26 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 25 0.26 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 23 1.1 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 23 1.1 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 23 1.1 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 23 1.1 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 23 1.1 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 23 1.1 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 23 1.1 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 23 1.4 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 23 1.4 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 1.4 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 23 1.4 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 1.4 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 23 1.8 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 23 1.8 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 23 1.8 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 3.2 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 3.2 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 3.2 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 3.2 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 3.2 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 3.2 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 3.2 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 3.2 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 3.2 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 3.2 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 3.2 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 3.2 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 3.2 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 3.2 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 3.2 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 3.2 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 3.2 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 3.2 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 3.2 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 3.2 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 22 3.2 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 3.2 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 3.2 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 3.2 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 3.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 3.2 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 3.2 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 3.2 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 3.2 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 3.2 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 3.2 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 3.2 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 3.2 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 3.2 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 3.2 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 3.2 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 4.2 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 5.6 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 5.6 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 5.6 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 5.6 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 5.6 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 5.6 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 5.6 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 5.6 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 5.6 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 5.6 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 5.6 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 5.6 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 5.6 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 5.6 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 5.6 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 5.6 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 5.6 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 5.6 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.4 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 20 9.8 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 20 9.8 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 20 9.8 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.4 bits (53), Expect = 0.26 Identities = 13/42 (30%), Positives = 22/42 (52%) Query: 107 SWSAGRSLQPPVDLGYNDSSQEKEDVIPERKNKYSKAQARQR 148 S S R+ + D Y EKE ++ ER N+ +++R+R Sbjct: 3 SCSRDRNREYRKDRRYEKLHNEKEKLLEERTNRKRNSRSRER 44 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.4 bits (53), Expect = 0.26 Identities = 13/42 (30%), Positives = 22/42 (52%) Query: 107 SWSAGRSLQPPVDLGYNDSSQEKEDVIPERKNKYSKAQARQR 148 S S R+ + D Y EKE ++ ER N+ +++R+R Sbjct: 3 SCSRDRNREYRKDRRYEKLHNEKEKLLEERTNRKRNSRSRER 44 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Query: 122 YNDSSQEKEDVIPER--KNKYSKAQARQR 148 Y EKE ++ ER +N+YS+++ R++ Sbjct: 19 YEKLHNEKEKLLEERTSRNRYSRSREREQ 47 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Query: 122 YNDSSQEKEDVIPER--KNKYSKAQARQR 148 Y EKE ++ ER +N+YS+++ R++ Sbjct: 19 YEKLHNEKEKLLEERTSRNRYSRSREREQ 47 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Query: 122 YNDSSQEKEDVIPER--KNKYSKAQARQR 148 Y EKE ++ ER +N+YS+++ R++ Sbjct: 19 YEKLHNEKEKLLEERTSRNRYSRSREREQ 47 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Query: 122 YNDSSQEKEDVIPER--KNKYSKAQARQR 148 Y EKE ++ ER +N+YS+++ R++ Sbjct: 19 YEKLHNEKEKLLEERTSRNRYSRSREREQ 47 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Query: 122 YNDSSQEKEDVIPER--KNKYSKAQARQR 148 Y EKE ++ ER +N+YS+++ R++ Sbjct: 19 YEKLHNEKEKLLEERTSRNRYSRSREREQ 47 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Query: 122 YNDSSQEKEDVIPER--KNKYSKAQARQR 148 Y EKE ++ ER +N+YS+++ R++ Sbjct: 19 YEKLHNEKEKLLEERTSRNRYSRSREREQ 47 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/29 (34%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Query: 122 YNDSSQEKEDVIPER--KNKYSKAQARQR 148 Y EKE ++ ER +N+YS+++ R++ Sbjct: 19 YEKLHNEKEKLLEERTSRNRYSRSREREQ 47 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.0 bits (47), Expect = 1.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 119 DLGYNDSSQEKEDVIPERKNKYSKAQARQRYKQ 151 D Y EKE ++ ER ++ +++R+R K+ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREKK 48 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.0 bits (47), Expect = 1.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 119 DLGYNDSSQEKEDVIPERKNKYSKAQARQRYKQ 151 D Y EKE ++ ER ++ +++R+R K+ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREKK 48 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.0 bits (47), Expect = 1.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 119 DLGYNDSSQEKEDVIPERKNKYSKAQARQRYKQ 151 D Y EKE ++ ER ++ +++R+R K+ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREKK 48 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.0 bits (47), Expect = 1.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 119 DLGYNDSSQEKEDVIPERKNKYSKAQARQRYKQ 151 D Y EKE ++ ER ++ +++R+R K+ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREKK 48 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.0 bits (47), Expect = 1.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Query: 119 DLGYNDSSQEKEDVIPERKNKYSKAQARQRYKQ 151 D Y EKE ++ ER ++ +++R+R K+ Sbjct: 249 DRRYEKLHNEKEKLLEERTSRKRYSRSREREKK 281 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.6 bits (46), Expect = 1.8 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR--YKQGK 153 D Y EKE ++ ER + +YS+++ R++ YK K Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEK 54 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.6 bits (46), Expect = 1.8 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR--YKQGK 153 D Y EKE ++ ER + +YS+++ R++ YK K Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEK 54 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.6 bits (46), Expect = 1.8 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR--YKQGK 153 D Y EKE ++ ER + +YS+++ R++ YK K Sbjct: 16 DRQYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEK 54 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 47 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 238 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 269 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 249 DRQYEKLHNEKEKLLEERTSRKRYSRSREREQ 280 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 238 DRQYEKLHNEKEKLLEERTSRKRYSRSREREQ 269 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 249 DRQYEKLHNEKEKLLEERTSRKRYSRSREREQ 280 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 249 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 280 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 249 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 280 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 238 DRQYEKLHNEKEKLLEERTSRKRYSRSREREQ 269 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 249 DRQYEKLHNEKEKLLEERTSRKRYSRSREREQ 280 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 249 DRQYEKLHNEKEKLLEERTSRKRYSRSREREQ 280 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 238 DRQYEKLHNEKEKLLEERTSRKRYSRSREREQ 269 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 249 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 280 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 238 DRQYEKLHNEKEKLLEERTSRKRYSRSREREQ 269 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 254 DRRYEKLHNEKEKLLEERTSRKRYSRSREREQ 285 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 249 DRRYEKLHNEKEKLLEERTSRERYSRSREREQ 280 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 8 TTVEELKIKGNECVKDGKFIEAVLHYTQAIKMDPN 42 T+V+ L+++G+E G + HY M P+ Sbjct: 748 TSVKSLRLEGDETPPYGMELTEAEHYALYTAMAPH 782 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 4.2 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE ++ ER + +YS+++ R++ Sbjct: 16 DRRYEKLYNEKEKLLEERTSRKRYSRSREREQ 47 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRRYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 16 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQ 47 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 249 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQ 280 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 5.6 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 119 DLGYNDSSQEKEDVIPER--KNKYSKAQARQR 148 D Y EKE + ER + +YS+++ R++ Sbjct: 249 DRQYEKLHNEKEKFLEERTSRKRYSRSREREQ 280 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 20.6 bits (41), Expect = 7.4 Identities = 7/29 (24%), Positives = 15/29 (51%) Query: 103 TMMSSWSAGRSLQPPVDLGYNDSSQEKED 131 T++ W+ ++ P+ LG N++ D Sbjct: 306 TILLVWAISAAIGSPIVLGLNNTPDRTPD 334 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 20.2 bits (40), Expect = 9.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Query: 96 FVVGKTTTMMSSWSAGRSLQPPVDLGYNDSS 126 F V T+ + +GR+ Q LGY++S+ Sbjct: 289 FCVNIVTSYCKTCISGRAFQVLTWLGYSNSA 319 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.2 bits (40), Expect = 9.8 Identities = 11/48 (22%), Positives = 21/48 (43%) Query: 106 SSWSAGRSLQPPVDLGYNDSSQEKEDVIPERKNKYSKAQARQRYKQGK 153 S +S RS + Y + E + E+K + +R+RY + + Sbjct: 229 SRYSRERSCSRDRNREYKKKDRRYEKLHNEKKKLLEERTSRKRYSRSR 276 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 20.2 bits (40), Expect = 9.8 Identities = 7/22 (31%), Positives = 15/22 (68%) Query: 129 KEDVIPERKNKYSKAQARQRYK 150 K+++IP++ + SK + Q Y+ Sbjct: 191 KDNLIPDKNDPDSKECSNQEYE 212 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.314 0.129 0.370 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,715 Number of Sequences: 429 Number of extensions: 1984 Number of successful extensions: 76 Number of sequences better than 10.0: 76 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of query: 154 length of database: 140,377 effective HSP length: 53 effective length of query: 101 effective length of database: 117,640 effective search space: 11881640 effective search space used: 11881640 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -