BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001541-TA|BGIBMGA001541-PA|IPR013026|Tetratricopeptide region, IPR001440|Tetratricopeptide TPR_1 (154 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 1.5 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 20 8.3 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 20 8.3 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 20 8.3 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 20 8.3 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 22.6 bits (46), Expect = 1.5 Identities = 16/64 (25%), Positives = 31/64 (48%), Gaps = 4/64 (6%) Query: 43 NYILHSNRSFAFLKLDQHYLSLQDANETVRLQPQWAKNPFSMVAFSMALSGLGFVVGKTT 102 NY++ SN++ +L L++ YL ++ + + L P K P + L + F + Sbjct: 18 NYLILSNKNNTYLVLNK-YLLVKHSKPKMPLLP---KTPLPLTLLYKLLGIIQFPISAHF 73 Query: 103 TMMS 106 + MS Sbjct: 74 SFMS 77 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 20.2 bits (40), Expect = 8.3 Identities = 10/23 (43%), Positives = 11/23 (47%) Query: 119 DLGYNDSSQEKEDVIPERKNKYS 141 D YN +ED IP NK S Sbjct: 75 DCPYNTQDCYREDCIPGDGNKRS 97 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 20.2 bits (40), Expect = 8.3 Identities = 6/19 (31%), Positives = 11/19 (57%) Query: 100 KTTTMMSSWSAGRSLQPPV 118 KT + W+AG ++ P+ Sbjct: 97 KTIISIGGWNAGNAILAPI 115 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 20.2 bits (40), Expect = 8.3 Identities = 7/17 (41%), Positives = 10/17 (58%) Query: 20 CVKDGKFIEAVLHYTQA 36 C KDG I H+++A Sbjct: 621 CPKDGHVILETFHFSEA 637 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 20.2 bits (40), Expect = 8.3 Identities = 7/17 (41%), Positives = 10/17 (58%) Query: 20 CVKDGKFIEAVLHYTQA 36 C KDG I H+++A Sbjct: 621 CPKDGHVILETFHFSEA 637 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.129 0.370 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,128 Number of Sequences: 317 Number of extensions: 1331 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 154 length of database: 114,650 effective HSP length: 52 effective length of query: 102 effective length of database: 98,166 effective search space: 10012932 effective search space used: 10012932 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -