SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001540-TA|BGIBMGA001540-PA|IPR006935|Type III
restriction enzyme, res subunit
         (1032 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase p...    24   5.5  

>EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase
           protein.
          Length = 620

 Score = 24.2 bits (50), Expect = 5.5
 Identities = 16/53 (30%), Positives = 21/53 (39%)

Query: 29  QGSEFEFTDFTLPSQSQTQASQHDHGLSSSNQVNGIGRIELSSKISNVTNTIP 81
           QG +F     T P       S H+   S     N   R +L +KI +   TIP
Sbjct: 359 QGIQFHLYINTAPCGDARIFSPHEENESVDKHPNRRARGQLRTKIESGEGTIP 411


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.135    0.402 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 274,237
Number of Sequences: 429
Number of extensions: 10928
Number of successful extensions: 14
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 13
Number of HSP's gapped (non-prelim): 1
length of query: 1032
length of database: 140,377
effective HSP length: 65
effective length of query: 967
effective length of database: 112,492
effective search space: 108779764
effective search space used: 108779764
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 48 (23.4 bits)

- SilkBase 1999-2023 -