BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001539-TA|BGIBMGA001539-PA|undefined (338 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 29 0.25 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 27 0.75 AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825726-1|AAV70289.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine p... 25 2.3 AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine p... 25 2.3 AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine p... 25 2.3 AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine p... 25 2.3 AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825689-1|AAV70252.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine p... 25 2.3 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 7.0 AY846632-1|AAW31598.1| 412|Anopheles gambiae SAGLIN protein. 23 9.2 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 9.2 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 23 9.2 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 9.2 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 9.2 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 28.7 bits (61), Expect = 0.25 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 3/52 (5%) Query: 254 KLCSILGQGEMR--DKAEVLVEVERLNSVQAELTAEIATLHSELEKERSKNT 303 + C+ +G +R ++ E++++ ER +AE +I +++ LE ERSK+T Sbjct: 791 EFCARIGVANIRQFEERELVLQQERAKK-RAEFEQQIDRINNNLEFERSKDT 841 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 27.1 bits (57), Expect = 0.75 Identities = 21/88 (23%), Positives = 38/88 (43%), Gaps = 5/88 (5%) Query: 102 LSKLDYEEKKDVYKQLKKDVDAANKVAEVSRNVKKLKKKNVMCLEQFNGIVNSTENSDVK 161 L+K EEK+ Y Q K++++A + + ++ K K V ++ +NS E + Sbjct: 249 LAKKCTEEKEQQYNQFKQEMEA---ILARKKELETSKAKQVAIGQRSTDEINSLEEKTER 305 Query: 162 FNHNTEDEKNSTDD--DKIPEKDTQFFE 187 +K D K E+ T+ E Sbjct: 306 LEDTISKQKRELMDALAKADERKTELDE 333 Score = 23.8 bits (49), Expect = 7.0 Identities = 13/46 (28%), Positives = 23/46 (50%) Query: 255 LCSILGQGEMRDKAEVLVEVERLNSVQAELTAEIATLHSELEKERS 300 LC L Q ++D ++ LN+ + T E+ EL+++RS Sbjct: 133 LCQFLPQDRVQDFTKMNPRELLLNTQSSVCTPEVQQWFEELKEKRS 178 >AY825734-1|AAV70297.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825733-1|AAV70296.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825732-1|AAV70295.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825731-1|AAV70294.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825730-1|AAV70293.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825729-1|AAV70292.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825728-1|AAV70291.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825727-1|AAV70290.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825726-1|AAV70289.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825725-1|AAV70288.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825724-1|AAV70287.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825723-1|AAV70286.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825722-1|AAV70285.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825721-1|AAV70284.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825720-1|AAV70283.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825719-1|AAV70282.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825718-1|AAV70281.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825717-1|AAV70280.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825716-1|AAV70279.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825715-1|AAV70278.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825714-1|AAV70277.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825713-1|AAV70276.1| 156|Anopheles gambiae subtilase serine protease protein. Length = 156 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825712-1|AAV70275.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825711-1|AAV70274.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825710-1|AAV70273.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825709-1|AAV70272.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825708-1|AAV70271.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825707-1|AAV70270.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825706-1|AAV70269.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825705-1|AAV70268.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825704-1|AAV70267.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825703-1|AAV70266.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825702-1|AAV70265.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825701-1|AAV70264.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825700-1|AAV70263.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 101 YQTAQISKLDAENAENVYQALLKD 124 >AY825699-1|AAV70262.1| 161|Anopheles gambiae subtilase serine protease protein. Length = 161 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 101 YQTAQISKLDAENAENVYQALLKD 124 >AY825698-1|AAV70261.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825697-1|AAV70260.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825696-1|AAV70259.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825695-1|AAV70258.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825694-1|AAV70257.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825693-1|AAV70256.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825692-1|AAV70255.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825691-1|AAV70254.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825690-1|AAV70253.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825689-1|AAV70252.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825688-1|AAV70251.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825687-1|AAV70250.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825686-1|AAV70249.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY825685-1|AAV70248.1| 159|Anopheles gambiae subtilase serine protease protein. Length = 159 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 97 HQAILLSKLDYEEKKDVYKQLKKD 120 +Q +SKLD E ++VY+ L KD Sbjct: 99 YQTAQISKLDAENAENVYQALLKD 122 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.8 bits (49), Expect = 7.0 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 145 LEQFNGIVNSTENSDVKFNHNTEDEKNSTD 174 L+ NG++ E S V +T D+K +D Sbjct: 1251 LKMENGVIAEVEKSQVDGEDDTGDKKTDSD 1280 >AY846632-1|AAW31598.1| 412|Anopheles gambiae SAGLIN protein. Length = 412 Score = 23.4 bits (48), Expect = 9.2 Identities = 12/44 (27%), Positives = 21/44 (47%) Query: 82 QKDEEMVDGNFESELHQAILLSKLDYEEKKDVYKQLKKDVDAAN 125 +++ E +LH A ++ + E KK + KQL D+ N Sbjct: 109 EQEHRQYAATLEEQLHAAQQETQQEQEMKKALQKQLDALTDSRN 152 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 9.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Query: 282 AELTAEIATLHSELEKERSKNTDPR 306 AE I+ LHS +E +K +DPR Sbjct: 134 AEYIGVISRLHSVVEFSSAKPSDPR 158 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 23.4 bits (48), Expect = 9.2 Identities = 10/38 (26%), Positives = 18/38 (47%) Query: 76 QWAQWKQKDEEMVDGNFESELHQAILLSKLDYEEKKDV 113 QW + +KD+ + +E H L S+ + E D+ Sbjct: 209 QWRELMEKDDAVKQSFISTEDHTKFLQSRKNGENNYDI 246 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.4 bits (48), Expect = 9.2 Identities = 13/44 (29%), Positives = 19/44 (43%) Query: 261 QGEMRDKAEVLVEVERLNSVQAELTAEIATLHSELEKERSKNTD 304 QG+ + K E+ERL AE E+ + E R K + Sbjct: 317 QGDNKSKERAEQELERLKITIAEKEKELEQVRPRYEAMRRKEEE 360 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.4 bits (48), Expect = 9.2 Identities = 8/22 (36%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Query: 198 IRNKIKERIHNRLT-DEVITKI 218 IRN++++R H+R+T D +++++ Sbjct: 961 IRNEMQQRCHSRVTMDNIVSEM 982 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.308 0.126 0.335 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 258,861 Number of Sequences: 2123 Number of extensions: 8984 Number of successful extensions: 80 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 61 length of query: 338 length of database: 516,269 effective HSP length: 64 effective length of query: 274 effective length of database: 380,397 effective search space: 104228778 effective search space used: 104228778 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -