BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001538-TA|BGIBMGA001538-PA|IPR006849|IKI3 (590 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 25 1.1 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 25 1.1 DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 23 7.8 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 7.8 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 25.4 bits (53), Expect = 1.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 10 LAIVTKEMHMVLLSCTYDPINEIKLHNQEFGEK 42 L ++T + + LL+C N +K N+EF EK Sbjct: 243 LILITGKSIVQLLTCLNFITNNLKSENEEFKEK 275 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 25.4 bits (53), Expect = 1.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 10 LAIVTKEMHMVLLSCTYDPINEIKLHNQEFGEK 42 L ++T + + LL+C N +K N+EF EK Sbjct: 243 LILITGKSIVQLLTCLNFITNNLKSENEEFKEK 275 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 22.6 bits (46), Expect = 7.8 Identities = 16/47 (34%), Positives = 19/47 (40%) Query: 310 APKNENVNPNSFFVITVDNKLLFYSQKEKHPLNYEAYNSQQFDKSDF 356 APK N NS I + N L K K P+ A + KS F Sbjct: 15 APKIVNSKYNSILNIALKNFRLCKKHKTKKPVQILALLQEIIPKSYF 61 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.6 bits (46), Expect = 7.8 Identities = 16/47 (34%), Positives = 19/47 (40%) Query: 310 APKNENVNPNSFFVITVDNKLLFYSQKEKHPLNYEAYNSQQFDKSDF 356 APK N NS I + N L K K P+ A + KS F Sbjct: 15 APKIVNSKYNSILNIALKNFRLCKKHKTKKPVQILALLQEIIPKSYF 61 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,167 Number of Sequences: 317 Number of extensions: 6283 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 6 length of query: 590 length of database: 114,650 effective HSP length: 61 effective length of query: 529 effective length of database: 95,313 effective search space: 50420577 effective search space used: 50420577 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -