BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001538-TA|BGIBMGA001538-PA|IPR006849|IKI3 (590 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 29 0.46 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 9.8 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 28.7 bits (61), Expect = 0.46 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 202 TTSNYHWYLKQTLLFRSNQRINKIIWDNDFDISN 235 T Y W ++QTL+F + +N I+ D+ D++N Sbjct: 105 TDEEYMWCIRQTLIFPDGKPLNMIL-DDGGDLTN 137 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 24.2 bits (50), Expect = 9.8 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 299 KLESTAQAICFAPKNENVNPNSFFVITVDNKLLFYSQKEKHPLNYEAYNSQQFDK 353 K + A+ A ++ +N N + TVD K + QKE H + N + DK Sbjct: 920 KADHGLSALHLAQQDYQLNCN---IKTVDGKGATWKQKELHGTHTHQLNLEHIDK 971 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 605,118 Number of Sequences: 2123 Number of extensions: 23154 Number of successful extensions: 44 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 43 Number of HSP's gapped (non-prelim): 2 length of query: 590 length of database: 516,269 effective HSP length: 68 effective length of query: 522 effective length of database: 371,905 effective search space: 194134410 effective search space used: 194134410 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -