BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001538-TA|BGIBMGA001538-PA|IPR006849|IKI3 (590 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 24 4.0 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 9.4 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.8 bits (49), Expect = 4.0 Identities = 15/66 (22%), Positives = 28/66 (42%), Gaps = 4/66 (6%) Query: 27 DPINEIKLHNQEFGEKQFITVGWGKKETQFHGSEGKQAAKIKNDIVSDDSTASDKVKITW 86 DP+ + + + E+ IT W E S + N + + T + +K++W Sbjct: 197 DPLCSFAIESISY-EQTAITYVWKNDEGTLRKSPSLTSL---NAYLIKNQTITCPIKVSW 252 Query: 87 RGDGNL 92 R DG + Sbjct: 253 RADGQI 258 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.6 bits (46), Expect = 9.4 Identities = 11/34 (32%), Positives = 15/34 (44%) Query: 319 NSFFVITVDNKLLFYSQKEKHPLNYEAYNSQQFD 352 +SF I LF + K P N + YN+ D Sbjct: 347 SSFGKILATEPTLFSNVTPKFPRNIDEYNNNDLD 380 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,304 Number of Sequences: 429 Number of extensions: 7446 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 2 length of query: 590 length of database: 140,377 effective HSP length: 61 effective length of query: 529 effective length of database: 114,208 effective search space: 60416032 effective search space used: 60416032 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -