BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001536-TA|BGIBMGA001536-PA|IPR003010|Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase (385 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 6.4 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 22 6.4 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.2 bits (45), Expect = 6.4 Identities = 9/30 (30%), Positives = 16/30 (53%) Query: 319 YVTAPDGSRTPGLSRIKDGLLIAQVDLNLC 348 Y DGS+ + R + L+ ++LN+C Sbjct: 459 YTCVSDGSKLVSIQRKCNHGLVYDLELNIC 488 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Query: 70 PRIVRLGLIQHSIAISTDNPITQQRLAIFEK 100 P IVR L +H P T Q+L EK Sbjct: 102 PPIVRCALRKHKPNRKPRTPFTTQQLLALEK 132 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.136 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,806 Number of Sequences: 317 Number of extensions: 4103 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 385 length of database: 114,650 effective HSP length: 58 effective length of query: 327 effective length of database: 96,264 effective search space: 31478328 effective search space used: 31478328 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -