BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001533-TA|BGIBMGA001533-PA|IPR003599|Immunoglobulin subtype, IPR003598|Immunoglobulin subtype 2, IPR007110|Immunoglobulin-like, IPR013151|Immunoglobulin (335 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0961 + 29715938-29716034,29716918-29717133,29717438-297177... 33 0.32 11_06_0390 - 23060034-23060399,23060486-23060573,23061767-230618... 31 0.99 07_03_0149 - 14452654-14452666,14452943-14454699,14454886-144549... 29 4.0 11_06_0478 + 24073295-24074172,24074790-24075090 29 5.3 04_01_0567 - 7263744-7263922,7264020-7264259,7264919-7264982,726... 29 7.0 01_03_0260 - 14323503-14323603,14323751-14323990,14324212-143242... 29 7.0 03_06_0619 - 35136435-35136728,35137155-35137358,35137476-351376... 28 9.2 >04_04_0961 + 29715938-29716034,29716918-29717133,29717438-29717776, 29718247-29719274,29719465-29719551,29719636-29720043, 29720394-29720558,29720742-29721036,29721131-29721345, 29721838-29722143,29722474-29722537,29722644-29722883, 29722959-29723062 Length = 1187 Score = 33.1 bits (72), Expect = 0.32 Identities = 11/40 (27%), Positives = 26/40 (65%) Query: 89 YFEEEKYTQVTAHVGAEALLNCRVVMLKDKTVMWLRNTTD 128 Y ++ ++ V AH G++ +C + +LKDKT++++ + + Sbjct: 541 YLFDDPFSAVDAHTGSQLFKDCLMGILKDKTILYVTHQVE 580 >11_06_0390 - 23060034-23060399,23060486-23060573,23061767-23061843, 23062971-23063057 Length = 205 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/35 (42%), Positives = 17/35 (48%) Query: 151 QYPNNWRLSMNPVKRSDAGHYMCQISTHPPRTIFT 185 Q P + M P AGHYM Q+ PPRT T Sbjct: 77 QNPGSRPQMMQPGATPGAGHYMSQVPMFPPRTPLT 111 >07_03_0149 - 14452654-14452666,14452943-14454699,14454886-14454990, 14455808-14455978,14456309-14456641,14456900-14457492, 14458864-14458906 Length = 1004 Score = 29.5 bits (63), Expect = 4.0 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 20 RRRRSEEKDSLALSREIFKNITKQLRENIKREGATDKTDHLLQTKVEDTRNYAPYQSY 77 R+RR E +L + + N+ K R+N + + A D L QT V +N P QSY Sbjct: 236 RKRRKSEPTTL-VDGDGGTNLGKGKRKNHQNQAAVDSILDLQQTVVPLQQNDVPSQSY 292 >11_06_0478 + 24073295-24074172,24074790-24075090 Length = 392 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Query: 139 PYTGDSRIAVKFQYPNNWRLSMNPVKRSDAGH 170 PY G S++ V F + ++W+LS+ +K S H Sbjct: 318 PYLGKSKMGVSFGFIHDWQLSIWILKESTYQH 349 >04_01_0567 - 7263744-7263922,7264020-7264259,7264919-7264982, 7265088-7265393,7265652-7265866,7266195-7266489, 7266596-7266655,7267091-7267717,7268510-7268596, 7269292-7269612,7270051-7270224,7272806-7275022 Length = 1594 Score = 28.7 bits (61), Expect = 7.0 Identities = 12/40 (30%), Positives = 21/40 (52%) Query: 89 YFEEEKYTQVTAHVGAEALLNCRVVMLKDKTVMWLRNTTD 128 Y ++ ++ V AH G+ C MLK KT++ + + D Sbjct: 885 YLLDDVFSAVDAHTGSSIFKECLRGMLKGKTILLVTHQVD 924 >01_03_0260 - 14323503-14323603,14323751-14323990,14324212-14324275, 14324349-14324654,14324841-14325055,14325551-14325845, 14325965-14326129,14326324-14327352,14333553-14333814, 14334135-14334631,14338714-14340123 Length = 1527 Score = 28.7 bits (61), Expect = 7.0 Identities = 12/40 (30%), Positives = 23/40 (57%) Query: 89 YFEEEKYTQVTAHVGAEALLNCRVVMLKDKTVMWLRNTTD 128 Y ++ ++ V AH G++ +C L+DKTV+ + + D Sbjct: 811 YLLDDVFSAVDAHTGSDIFRDCVRGALRDKTVLLVTHQLD 850 >03_06_0619 - 35136435-35136728,35137155-35137358,35137476-35137646, 35137902-35138050,35138380-35138527,35138614-35138682, 35138767-35139027,35139223-35139417,35139772-35139888, 35140026-35140961 Length = 847 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/35 (34%), Positives = 16/35 (45%) Query: 139 PYTGDSRIAVKFQYPNNWRLSMNPVKRSDAGHYMC 173 P TG+ V+ NWR ++P GH MC Sbjct: 773 PETGECVRRVREMAEENWRAYVSPEMEETKGHLMC 807 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.319 0.134 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,411,512 Number of Sequences: 37544 Number of extensions: 248974 Number of successful extensions: 484 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 477 Number of HSP's gapped (non-prelim): 7 length of query: 335 length of database: 14,793,348 effective HSP length: 82 effective length of query: 253 effective length of database: 11,714,740 effective search space: 2963829220 effective search space used: 2963829220 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -