BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001532-TA|BGIBMGA001532-PA|undefined (122 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. 23 4.0 AJ000038-1|CAA03874.1| 73|Anopheles gambiae F1 protein protein. 23 4.0 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 21 9.2 >Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. Length = 101 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/17 (47%), Positives = 13/17 (76%) Query: 6 RLYSVTFLCLWTIVVIQ 22 +L+ + FLCL +VV+Q Sbjct: 4 KLFVLAFLCLALVVVVQ 20 >AJ000038-1|CAA03874.1| 73|Anopheles gambiae F1 protein protein. Length = 73 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/17 (47%), Positives = 13/17 (76%) Query: 6 RLYSVTFLCLWTIVVIQ 22 +L+ + FLCL +VV+Q Sbjct: 4 KLFVLAFLCLALVVVVQ 20 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 21.4 bits (43), Expect = 9.2 Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 53 YKLELGDMEKTCQFLTNTKCPIPSGQEVHFSLEILIEDDFPKNQQLTVEFI-IED 106 Y+LE + + + + P P Q+ + +E + KN Q +F+ +ED Sbjct: 39 YELEKETAHRMAESMDTSHKPNPLEQKTNAHIEKIFLITLNKNPQKNKQFVYVED 93 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.325 0.139 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,105 Number of Sequences: 2123 Number of extensions: 4078 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 3 length of query: 122 length of database: 516,269 effective HSP length: 57 effective length of query: 65 effective length of database: 395,258 effective search space: 25691770 effective search space used: 25691770 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -