BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001531-TA|BGIBMGA001531-PA|IPR000276|Rhodopsin-like GPCR superfamily (364 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06210.1 68416.m00714 expressed protein contains Prosite PS00... 33 0.40 At5g38630.1 68418.m04672 cytochrome B561 family protein contains... 29 6.4 At3g59520.1 68416.m06642 rhomboid family protein contains Pfam p... 29 6.4 At3g55310.1 68416.m06143 short-chain dehydrogenase/reductase (SD... 29 6.4 At1g20530.1 68414.m02558 hypothetical protein 28 8.5 >At3g06210.1 68416.m00714 expressed protein contains Prosite PS00616: Histidine acid phosphatases phosphohistidine signature; Length = 840 Score = 32.7 bits (71), Expect = 0.40 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 4/95 (4%) Query: 252 WQEQAYTTLSLVFMFILPLIILVSTYVSTVRTIAQ-SEKVFKPEVRRQEKYFTPDMNRRR 310 WQ QA T+S V I +L S+ +S +R + + S+ +FKP + + T + R+ Sbjct: 137 WQHQATWTVSGVG--ISSFRVLQSSSISLLRNLKRISDGIFKPILDNGLREATTRIGRQE 194 Query: 311 LIDRAKMKSLRMSVVIVAAFLIW-WTPYYVMMIIF 344 + DR + + S V + + W + YV I++ Sbjct: 195 IFDRRTTLTWKNSEVPLLPYARWLYISSYVSRILY 229 >At5g38630.1 68418.m04672 cytochrome B561 family protein contains Pfam domain, PF03188: Cytochrome b561 Length = 230 Score = 28.7 bits (61), Expect = 6.4 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 9/67 (13%) Query: 130 IFQLSIADLLVTIFCIAGEAAWSF-AVQWYAGNIGCKLFKFLQMLALYLSTFVLVLIGVD 188 IF + +++ + GEA ++ +VQ G K K L L L L+ F+L LIGV Sbjct: 47 IFNVHPVMMVIGLILFNGEAMLAYKSVQ------GTKNLKKLVHLTLQLTAFILSLIGV- 99 Query: 189 RWLAVKY 195 W A+K+ Sbjct: 100 -WAALKF 105 >At3g59520.1 68416.m06642 rhomboid family protein contains Pfam profile PF01694: Rhomboid family Length = 269 Score = 28.7 bits (61), Expect = 6.4 Identities = 28/104 (26%), Positives = 45/104 (43%), Gaps = 10/104 (9%) Query: 123 WTAIYSLIFQLSIADLLVTIFCIAGEAAWSFAVQWYAGNIGCKLFKFLQ-MLALYLSTFV 181 W I S + +S+ L+ + A WS V G++G +L L L + + V Sbjct: 52 WRMITSALSHISVLHLVFNM-----SALWSLGVVEQLGHVGLGTAYYLHYTLVLVVFSGV 106 Query: 182 LVLIGVDRWLAVKYPMKSMATATRSG-RLVIIAWVLSVILSIPQ 224 LV IG+ L ++ + T G V+ W+ ILS+ Q Sbjct: 107 LV-IGIYHLLIARFKIDYFRRVTAVGYSCVVFGWM--TILSVKQ 147 >At3g55310.1 68416.m06143 short-chain dehydrogenase/reductase (SDR) family protein contains similarity to 3-oxoacyl-[acyl-carrier protein] reductase SP:P51831 from [Bacillus subtilis] Length = 298 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/44 (31%), Positives = 21/44 (47%) Query: 190 WLAVKYPMKSMATATRSGRLVIIAWVLSVILSIPQAVVFRVAKG 233 WL KY M A R G ++ I+ V V +P + + +KG Sbjct: 156 WLVAKYVCVLMRDAKRGGSVINISSVAGVRSIVPGGLAYSCSKG 199 >At1g20530.1 68414.m02558 hypothetical protein Length = 614 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/47 (31%), Positives = 25/47 (53%) Query: 279 STVRTIAQSEKVFKPEVRRQEKYFTPDMNRRRLIDRAKMKSLRMSVV 325 ST++ + EK EV+ +EK T M +L+ R + KS +S + Sbjct: 310 STLKKLFMWEKKLYQEVKAEEKLRTSHMKNYKLLRRLEAKSADLSKI 356 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.329 0.139 0.427 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,962,513 Number of Sequences: 28952 Number of extensions: 298459 Number of successful extensions: 821 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 818 Number of HSP's gapped (non-prelim): 6 length of query: 364 length of database: 12,070,560 effective HSP length: 82 effective length of query: 282 effective length of database: 9,696,496 effective search space: 2734411872 effective search space used: 2734411872 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -