BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001529-TA|BGIBMGA001529-PA|undefined (324 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 >SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/42 (35%), Positives = 23/42 (54%) Query: 2 SAPTIDSTEAITILDMGSSDETASLPGRRTRPLPVIVPSENR 43 S PT+ + LDMG+S++ P RR+ LP + P +R Sbjct: 659 SLPTLKIVDVFGGLDMGTSNKQLPRPHRRSTSLPSLSPDSSR 700 >SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Query: 5 TIDSTEAITILDMGSSDETASLPGRRTRPLPVIVP 39 ++ +T+ + + +S E ASLP T P+P I P Sbjct: 116 SVGTTQTLAVTTCSTSLELASLPTSATTPIPQIPP 150 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.321 0.133 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,629,496 Number of Sequences: 59808 Number of extensions: 340683 Number of successful extensions: 593 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 591 Number of HSP's gapped (non-prelim): 2 length of query: 324 length of database: 16,821,457 effective HSP length: 82 effective length of query: 242 effective length of database: 11,917,201 effective search space: 2883962642 effective search space used: 2883962642 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -