BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001528-TA|BGIBMGA001528-PA|IPR000980|SH2 motif (665 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 6.7 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 23 6.7 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.0 bits (47), Expect = 6.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 347 QEPASETSDNNKNNNSQK 364 +E E SD+N NNN ++ Sbjct: 452 EEAKKEESDSNNNNNKEE 469 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 23.0 bits (47), Expect = 6.7 Identities = 12/37 (32%), Positives = 17/37 (45%) Query: 625 GASTAFPSVPALMRHYVTAQRLPVRGAEHMALSTPLP 661 G T VP + + A LP +GA + L P+P Sbjct: 167 GNGTGVQLVPTRLANGDIALVLPTQGASPLPLLVPIP 203 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.130 0.366 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,059 Number of Sequences: 317 Number of extensions: 4188 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 665 length of database: 114,650 effective HSP length: 61 effective length of query: 604 effective length of database: 95,313 effective search space: 57569052 effective search space used: 57569052 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -