BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001527-TA|BGIBMGA001527-PA|undefined (52 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069579-1|AAL39724.1| 1491|Drosophila melanogaster LD31673p pro... 28 1.4 AF250842-1|AAF66060.1| 1491|Drosophila melanogaster multiple ast... 28 1.4 AF195498-1|AAG28470.1| 1491|Drosophila melanogaster Misexpressio... 28 1.4 AE014296-3475|AAN12153.1| 1491|Drosophila melanogaster CG32435-P... 28 1.4 AE014296-3474|AAN12152.1| 1491|Drosophila melanogaster CG32435-P... 28 1.4 AE014296-3473|AAN12151.1| 1491|Drosophila melanogaster CG32435-P... 28 1.4 AB031048-1|BAA94248.1| 1492|Drosophila melanogaster microtubule ... 28 1.4 >AY069579-1|AAL39724.1| 1491|Drosophila melanogaster LD31673p protein. Length = 1491 Score = 28.3 bits (60), Expect = 1.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Query: 13 SVPVDCVSAGPLQAPRPSSFHEISAPKMSLHVNSTIPESR 52 S P+ S PLQ+P F + + L ++ST P SR Sbjct: 1082 SSPLSSSSPKPLQSPSVGPFASLQSHHHQLSISSTSPRSR 1121 >AF250842-1|AAF66060.1| 1491|Drosophila melanogaster multiple asters protein. Length = 1491 Score = 28.3 bits (60), Expect = 1.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Query: 13 SVPVDCVSAGPLQAPRPSSFHEISAPKMSLHVNSTIPESR 52 S P+ S PLQ+P F + + L ++ST P SR Sbjct: 1082 SSPLSSSSPKPLQSPSVGPFASLQSHHHQLSISSTSPRSR 1121 >AF195498-1|AAG28470.1| 1491|Drosophila melanogaster Misexpression suppressor of ras 7 protein. Length = 1491 Score = 28.3 bits (60), Expect = 1.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Query: 13 SVPVDCVSAGPLQAPRPSSFHEISAPKMSLHVNSTIPESR 52 S P+ S PLQ+P F + + L ++ST P SR Sbjct: 1082 SSPLSSSSPKPLQSPSVGPFASLQSHHHQLSISSTSPRSR 1121 >AE014296-3475|AAN12153.1| 1491|Drosophila melanogaster CG32435-PC, isoform C protein. Length = 1491 Score = 28.3 bits (60), Expect = 1.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Query: 13 SVPVDCVSAGPLQAPRPSSFHEISAPKMSLHVNSTIPESR 52 S P+ S PLQ+P F + + L ++ST P SR Sbjct: 1082 SSPLSSSSPKPLQSPSVGPFASLQSHHHQLSISSTSPRSR 1121 >AE014296-3474|AAN12152.1| 1491|Drosophila melanogaster CG32435-PB, isoform B protein. Length = 1491 Score = 28.3 bits (60), Expect = 1.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Query: 13 SVPVDCVSAGPLQAPRPSSFHEISAPKMSLHVNSTIPESR 52 S P+ S PLQ+P F + + L ++ST P SR Sbjct: 1082 SSPLSSSSPKPLQSPSVGPFASLQSHHHQLSISSTSPRSR 1121 >AE014296-3473|AAN12151.1| 1491|Drosophila melanogaster CG32435-PA, isoform A protein. Length = 1491 Score = 28.3 bits (60), Expect = 1.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Query: 13 SVPVDCVSAGPLQAPRPSSFHEISAPKMSLHVNSTIPESR 52 S P+ S PLQ+P F + + L ++ST P SR Sbjct: 1082 SSPLSSSSPKPLQSPSVGPFASLQSHHHQLSISSTSPRSR 1121 >AB031048-1|BAA94248.1| 1492|Drosophila melanogaster microtubule associated-proteinorbit protein. Length = 1492 Score = 28.3 bits (60), Expect = 1.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Query: 13 SVPVDCVSAGPLQAPRPSSFHEISAPKMSLHVNSTIPESR 52 S P+ S PLQ+P F + + L ++ST P SR Sbjct: 1083 SSPLSSSSPKPLQSPSVGPFASLQSHHHQLSISSTSPRSR 1122 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.318 0.127 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,844,261 Number of Sequences: 52641 Number of extensions: 90040 Number of successful extensions: 176 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 169 Number of HSP's gapped (non-prelim): 7 length of query: 52 length of database: 24,830,863 effective HSP length: 33 effective length of query: 19 effective length of database: 23,093,710 effective search space: 438780490 effective search space used: 438780490 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -