BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001527-TA|BGIBMGA001527-PA|undefined (52 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z80214-5|CAJ76929.1| 916|Caenorhabditis elegans Hypothetical pr... 26 2.8 Z80214-4|CAB02263.1| 982|Caenorhabditis elegans Hypothetical pr... 26 2.8 Z81466-2|CAC42256.1| 954|Caenorhabditis elegans Hypothetical pr... 25 4.9 Z81466-1|CAB03869.1| 982|Caenorhabditis elegans Hypothetical pr... 25 4.9 AJ133374-1|CAB40208.1| 954|Caenorhabditis elegans lin-10 protei... 25 4.9 >Z80214-5|CAJ76929.1| 916|Caenorhabditis elegans Hypothetical protein C27D8.3b protein. Length = 916 Score = 26.2 bits (55), Expect = 2.8 Identities = 11/31 (35%), Positives = 15/31 (48%) Query: 16 VDCVSAGPLQAPRPSSFHEISAPKMSLHVNS 46 V C P +PRPS H++ S+H S Sbjct: 732 VACRDQTPRPSPRPSESHDLPTSSSSVHAPS 762 >Z80214-4|CAB02263.1| 982|Caenorhabditis elegans Hypothetical protein C27D8.3a protein. Length = 982 Score = 26.2 bits (55), Expect = 2.8 Identities = 11/31 (35%), Positives = 15/31 (48%) Query: 16 VDCVSAGPLQAPRPSSFHEISAPKMSLHVNS 46 V C P +PRPS H++ S+H S Sbjct: 798 VACRDQTPRPSPRPSESHDLPTSSSSVHAPS 828 >Z81466-2|CAC42256.1| 954|Caenorhabditis elegans Hypothetical protein C09H6.2b protein. Length = 954 Score = 25.4 bits (53), Expect = 4.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Query: 4 MMAALCADYSVPVDCVSAGPLQAPRPSS 31 MMAA A + +P LQ PRPSS Sbjct: 102 MMAASGAQFPIPFPMQFQPALQQPRPSS 129 >Z81466-1|CAB03869.1| 982|Caenorhabditis elegans Hypothetical protein C09H6.2a protein. Length = 982 Score = 25.4 bits (53), Expect = 4.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Query: 4 MMAALCADYSVPVDCVSAGPLQAPRPSS 31 MMAA A + +P LQ PRPSS Sbjct: 102 MMAASGAQFPIPFPMQFQPALQQPRPSS 129 >AJ133374-1|CAB40208.1| 954|Caenorhabditis elegans lin-10 protein protein. Length = 954 Score = 25.4 bits (53), Expect = 4.9 Identities = 13/28 (46%), Positives = 15/28 (53%) Query: 4 MMAALCADYSVPVDCVSAGPLQAPRPSS 31 MMAA A + +P LQ PRPSS Sbjct: 102 MMAASGAQFPIPFPMQFQPALQQPRPSS 129 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.318 0.127 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,399,415 Number of Sequences: 27539 Number of extensions: 42356 Number of successful extensions: 101 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 96 Number of HSP's gapped (non-prelim): 5 length of query: 52 length of database: 12,573,161 effective HSP length: 33 effective length of query: 19 effective length of database: 11,664,374 effective search space: 221623106 effective search space used: 221623106 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -