GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001527-TA|BGIBMGA001527-PA|undefined
         (52 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    20   2.1  

>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 20.2 bits (40), Expect = 2.1
 Identities = 9/31 (29%), Positives = 16/31 (51%)

Query: 8   LCADYSVPVDCVSAGPLQAPRPSSFHEISAP 38
           L A++S    CV+A P    R ++  ++  P
Sbjct: 679 LAAEHSGDYTCVAANPAAEVRYTAKLQVKVP 709


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.127    0.382 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,698
Number of Sequences: 429
Number of extensions: 582
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 52
length of database: 140,377
effective HSP length: 32
effective length of query: 20
effective length of database: 126,649
effective search space:  2532980
effective search space used:  2532980
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 35 (19.0 bits)
S2: 35 (18.2 bits)