BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001526-TA|BGIBMGA001526-PA|undefined (137 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 21 5.3 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 20 9.2 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 20.6 bits (41), Expect = 5.3 Identities = 11/30 (36%), Positives = 14/30 (46%) Query: 37 QNIHTLRTADLIRQRQGEEKSTLRSSYIIR 66 QNI RTA Q EK + +Y+ R Sbjct: 69 QNIRRYRTAFTREQLARLEKEFFKENYVSR 98 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 19.8 bits (39), Expect = 9.2 Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 8 VGLHSSRKKRDGSGTSQEVASSV 30 V LHS + KR G+ + S+ Sbjct: 24 VSLHSLKNKRSGASLQVGILDSL 46 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.130 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,081 Number of Sequences: 317 Number of extensions: 833 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 137 length of database: 114,650 effective HSP length: 51 effective length of query: 86 effective length of database: 98,483 effective search space: 8469538 effective search space used: 8469538 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.7 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -