BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001526-TA|BGIBMGA001526-PA|undefined (137 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 22 6.4 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 22 8.4 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 22.2 bits (45), Expect = 6.4 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 6/48 (12%) Query: 9 GLHSSRKKRDGSGTSQEVASSVPQEAEYQNIHTLRTADLIRQRQGEEK 56 G HSSR +R G Q+ ++ + Q H R +Q+Q +++ Sbjct: 204 GAHSSRNRRGRQGPQQQ------EQRQQQQQHQQREQQQQQQQQQQQQ 245 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 21.8 bits (44), Expect = 8.4 Identities = 12/39 (30%), Positives = 19/39 (48%) Query: 27 ASSVPQEAEYQNIHTLRTADLIRQRQGEEKSTLRSSYII 65 A P++AE+ H +R +LI + Q + L II Sbjct: 916 ACEEPEDAEHTIFHCVRHRELIIRLQHQVDEELTPENII 954 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.316 0.130 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,369 Number of Sequences: 2123 Number of extensions: 3391 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 137 length of database: 516,269 effective HSP length: 58 effective length of query: 79 effective length of database: 393,135 effective search space: 31057665 effective search space used: 31057665 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -