BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001524-TA|BGIBMGA001524-PA|undefined (130 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 3.3 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 20 7.7 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 20 7.7 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 3.3 Identities = 7/28 (25%), Positives = 15/28 (53%) Query: 61 YINCLDFISIVCTINFFTGVLIPSSVKY 88 Y+ +D ++C + F +L ++V Y Sbjct: 300 YVKAIDIYLVMCFVFVFAALLEYAAVNY 327 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 20.2 bits (40), Expect = 7.7 Identities = 8/33 (24%), Positives = 18/33 (54%) Query: 37 SEDQNEEKKGFDLQNKRINEGTKKYINCLDFIS 69 ++D +EE+ K ++G K Y ++F++ Sbjct: 40 ADDSDEEELSARPSFKTFDKGPKNYTTPVNFVA 72 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 20.2 bits (40), Expect = 7.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 82 IPSSVKYFIKLPQGLRN 98 IP + I LP G+RN Sbjct: 322 IPEEKRMVIILPDGIRN 338 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.139 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,621 Number of Sequences: 429 Number of extensions: 2315 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 130 length of database: 140,377 effective HSP length: 51 effective length of query: 79 effective length of database: 118,498 effective search space: 9361342 effective search space used: 9361342 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -