BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001523-TA|BGIBMGA001523-PA|undefined (69 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83235-9|CAI79209.1| 705|Caenorhabditis elegans Hypothetical pr... 87 2e-18 Z83235-8|CAB05774.2| 894|Caenorhabditis elegans Hypothetical pr... 87 2e-18 AC092690-3|AAK73857.1| 1145|Caenorhabditis elegans Hypothetical ... 28 0.92 AC024755-3|AAL65801.1| 231|Caenorhabditis elegans Hypothetical ... 25 8.6 >Z83235-9|CAI79209.1| 705|Caenorhabditis elegans Hypothetical protein K10C3.5b protein. Length = 705 Score = 86.6 bits (205), Expect = 2e-18 Identities = 39/67 (58%), Positives = 47/67 (70%) Query: 3 FSHWEVIDIDPFWRPCTEEEYLHWGEKYDGVNRAKAYMDSVRARKGLATDKQLVQHAEKQ 62 FSHW+VID DP+W P T EE +G K D N A+ YMD+VR RKGL T+ +V+ AEKQ Sbjct: 639 FSHWQVIDEDPYWTPSTLEEIEEFGLKGDSPNHARGYMDAVRRRKGLPTEDLIVESAEKQ 698 Query: 63 RTLSKNK 69 R L KNK Sbjct: 699 RNLKKNK 705 >Z83235-8|CAB05774.2| 894|Caenorhabditis elegans Hypothetical protein K10C3.5a protein. Length = 894 Score = 86.6 bits (205), Expect = 2e-18 Identities = 39/67 (58%), Positives = 47/67 (70%) Query: 3 FSHWEVIDIDPFWRPCTEEEYLHWGEKYDGVNRAKAYMDSVRARKGLATDKQLVQHAEKQ 62 FSHW+VID DP+W P T EE +G K D N A+ YMD+VR RKGL T+ +V+ AEKQ Sbjct: 828 FSHWQVIDEDPYWTPSTLEEIEEFGLKGDSPNHARGYMDAVRRRKGLPTEDLIVESAEKQ 887 Query: 63 RTLSKNK 69 R L KNK Sbjct: 888 RNLKKNK 894 >AC092690-3|AAK73857.1| 1145|Caenorhabditis elegans Hypothetical protein BE0003N10.3 protein. Length = 1145 Score = 27.9 bits (59), Expect = 0.92 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query: 18 CTEEEYLHWGEKYDGVNRAKAYMDSVRARKGLATDKQLVQHAEKQ-RTLSKN 68 C +EE+ W E Y+ ++R M ++ G A D Q H E+ R L +N Sbjct: 457 CYDEEFNPWKEAYEQLSRGVHVMKNLEQFVG-AADIQCFDHIEEALRFLDEN 507 >AC024755-3|AAL65801.1| 231|Caenorhabditis elegans Hypothetical protein Y34B4A.6 protein. Length = 231 Score = 24.6 bits (51), Expect = 8.6 Identities = 7/18 (38%), Positives = 10/18 (55%) Query: 14 FWRPCTEEEYLHWGEKYD 31 FW C + E +WG Y+ Sbjct: 192 FWNACKKPEMAYWGCNYE 209 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.318 0.132 0.426 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,687,906 Number of Sequences: 27539 Number of extensions: 55328 Number of successful extensions: 137 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 133 Number of HSP's gapped (non-prelim): 4 length of query: 69 length of database: 12,573,161 effective HSP length: 49 effective length of query: 20 effective length of database: 11,223,750 effective search space: 224475000 effective search space used: 224475000 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -