BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001522-TA|BGIBMGA001522-PA|IPR009022|Elongation factor G, III and V, IPR009000|Translation factor, IPR000795|Protein synthesis factor, GTP-binding, IPR004161|Elongation factor Tu, domain 2, IPR005517|Elongation factor G, domain IV (902 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 36 0.002 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 36 0.002 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 35 0.003 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 31 0.055 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 29 0.13 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 29 0.17 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 28 0.29 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 28 0.39 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 28 0.39 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 28 0.39 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 28 0.39 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 28 0.39 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 28 0.39 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 28 0.39 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 27 0.51 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 27 0.68 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 27 0.68 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 27 0.68 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 27 0.90 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 27 0.90 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 26 1.2 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 26 1.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 26 1.2 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 26 1.2 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 26 1.2 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 26 1.2 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 26 1.2 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 26 1.2 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 26 1.6 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 26 1.6 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 26 1.6 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 26 1.6 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 26 1.6 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 26 1.6 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 25 2.1 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 25 2.1 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 25 2.1 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 25 2.7 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 25 2.7 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 25 2.7 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 25 2.7 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 25 2.7 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 25 2.7 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 25 2.7 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 25 2.7 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 25 2.7 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 25 2.7 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 25 2.7 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 25 2.7 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 25 2.7 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 25 2.7 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 25 2.7 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 25 2.7 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 25 2.7 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 25 2.7 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 25 2.7 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 25 2.7 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 25 2.7 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 25 2.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 25 2.7 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 25 3.6 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 24 4.8 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 24 4.8 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 24 4.8 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 24 4.8 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 24 4.8 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 24 4.8 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 24 4.8 AY569719-1|AAS86672.1| 401|Apis mellifera complementary sex det... 24 4.8 AY569718-1|AAS86671.1| 401|Apis mellifera complementary sex det... 24 4.8 AY569715-1|AAS86668.1| 401|Apis mellifera complementary sex det... 24 4.8 AY569714-1|AAS86667.1| 401|Apis mellifera complementary sex det... 24 4.8 AY569713-1|AAS86666.1| 401|Apis mellifera complementary sex det... 24 4.8 AY569711-1|AAS86664.1| 401|Apis mellifera complementary sex det... 24 4.8 AY569702-1|AAS86655.1| 400|Apis mellifera complementary sex det... 24 4.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 24 4.8 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 24 6.3 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 6.3 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 8.4 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 8.4 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 8.4 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 8.4 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 23 8.4 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 23 8.4 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 23 8.4 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 23 8.4 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 23 8.4 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 23 8.4 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 23 8.4 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 23 8.4 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 23 8.4 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 23 8.4 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 23 8.4 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 8.4 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 8.4 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 8.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 8.4 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 8.4 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 8.4 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 8.4 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 8.4 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 8.4 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 23 8.4 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 35.5 bits (78), Expect = 0.002 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Query: 8 MDSRPDEQQRGITMKSSSISLYHAMNQEEYLVNLIDSPGHIDFSSEVSTAVRLCDGAI 65 +D E++RGIT+ I+L+ +Y V +ID+PGH DF + T D A+ Sbjct: 3 LDKLKAERERGITI---DIALWK-FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAV 56 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 35.5 bits (78), Expect = 0.002 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Query: 8 MDSRPDEQQRGITMKSSSISLYHAMNQEEYLVNLIDSPGHIDFSSEVSTAVRLCDGAI 65 +D E++RGIT+ I+L+ +Y V +ID+PGH DF + T D A+ Sbjct: 60 LDKLKAERERGITI---DIALWK-FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAV 113 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 35.1 bits (77), Expect = 0.003 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Query: 8 MDSRPDEQQRGITMKSSSISLYHAMNQEEYLVNLIDSPGHIDFSSEVSTAVRLCDGAI 65 +D E++RGIT+ I+L+ +Y V +ID+PGH DF + T D A+ Sbjct: 60 LDKLKAERERGITI---DIALWK-FETAKYYVTIIDAPGHRDFIKNMITGTSQADCAV 113 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 30.7 bits (66), Expect = 0.055 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 5/92 (5%) Query: 354 CD--SNENRPIIIFISKMFS--FDKSALPENRPKALTSEEMALRREKARQ-LREELKQNN 408 CD S R II S+ +S F S + P + S +L + Q +E +NN Sbjct: 6 CDRKSLSQRKIIRSRSRRYSKRFSSSIVDRRSPSSSRSPSPSLLTSQPHQDHNKEKSKNN 65 Query: 409 ANINRQSEEKSPHEEQEKSAEDENEKEKVTFI 440 + N+ +E+ + E + ++++ N+K++ FI Sbjct: 66 HHCNQDTEKLNQLEIESDNSKEVNDKKEENFI 97 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 29.5 bits (63), Expect = 0.13 Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 36 EYLVNLIDSPGHIDFSSEVSTAVRLCDGAI 65 +Y V +ID+PGH DF + T D A+ Sbjct: 11 KYYVTIIDAPGHRDFIKNMITGTSQADCAV 40 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 29.1 bits (62), Expect = 0.17 Identities = 15/63 (23%), Positives = 26/63 (41%) Query: 39 VNLIDSPGHIDFSSEVSTAVRLCDGAIXXXXXXXXXCPQTRLVLKQAYSENIRPVLVLNK 98 V +D+PGH F S + D + QT ++ A + ++ +NK Sbjct: 195 VTFLDTPGHAAFISMRHRGAHITDIVVLVVAADDGVKEQTLQSIEMAKDAKVPIIVAINK 254 Query: 99 IDR 101 ID+ Sbjct: 255 IDK 257 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 28.3 bits (60), Expect = 0.29 Identities = 13/58 (22%), Positives = 27/58 (46%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S ++K+ + +++ K+ Sbjct: 262 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDKTERERSKERKI 319 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 260 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKER 304 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.9 bits (59), Expect = 0.39 Identities = 14/45 (31%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E +N + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKER 66 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.9 bits (59), Expect = 0.39 Identities = 14/45 (31%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E +N + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKER 66 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.9 bits (59), Expect = 0.39 Identities = 14/45 (31%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E +N + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKER 66 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.9 bits (59), Expect = 0.39 Identities = 14/45 (31%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E +N + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKER 66 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.9 bits (59), Expect = 0.39 Identities = 14/45 (31%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E +N + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKER 66 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.9 bits (59), Expect = 0.39 Identities = 14/45 (31%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E +N + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKER 66 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.9 bits (59), Expect = 0.39 Identities = 14/45 (31%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E +N + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRNRYSRSREREQNSYKNEREYQKYRETSKER 66 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 27.5 bits (58), Expect = 0.51 Identities = 14/45 (31%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E+E E KE+ Sbjct: 255 LHNEKEKLLEERTSRERYSRSREREQKSYKNEREYRKYGETSKER 299 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 27.1 bits (57), Expect = 0.68 Identities = 14/45 (31%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYRKYRETSKER 66 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 27.1 bits (57), Expect = 0.68 Identities = 14/45 (31%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYRKYRETSKER 66 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 27.1 bits (57), Expect = 0.68 Identities = 12/58 (20%), Positives = 27/58 (46%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S ++++ + +++ K+ Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSKERKI 314 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKER 299 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 26.6 bits (56), Expect = 0.90 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S ++++ + + + K+ Sbjct: 257 NEKEKLLEERTSRKRYSCSREREQKSYKNENSYRKYRETSKERSRDRTERERSREPKI 314 Score = 25.4 bits (53), Expect = 2.1 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 255 LHNEKEKLLEERTSRKRYSCSREREQKSYKNENSYRKYRETSKER 299 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 26.6 bits (56), Expect = 0.90 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 6/42 (14%) Query: 741 KEDLQSICSKLGPDWKDLVSQIWSVGPRNCGPNMLLNHTADY 782 K +QS+ P+WKDL + SV ++L +H DY Sbjct: 737 KSTIQSLMKLKSPEWKDLAKKARSVN------HLLTHHEYDY 772 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S +++ + +++ K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRKERERSKEPKI 81 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKER 66 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S ++++ + + + K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREPKI 81 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKER 66 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S +++ + +++ K+ Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRKERERSKEPKI 314 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKER 299 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S ++++ + + + K+ Sbjct: 246 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREPKI 303 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 244 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKER 288 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S ++++ + + + K+ Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREPKI 314 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKER 299 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S ++++ + + + K+ Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREPKI 314 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKER 299 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S ++++ + + + K+ Sbjct: 246 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRTERERSREPKI 303 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 244 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKER 288 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 26.2 bits (55), Expect = 1.2 Identities = 14/45 (31%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + +R+ E+KS E+E E KE+ Sbjct: 255 LHNEKEKFLEERTSHKRYSRSREREQKSYKNEREYRKYRETSKER 299 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 25.8 bits (54), Expect = 1.6 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S +++ + +++ K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKI 81 Score = 24.2 bits (50), Expect = 4.8 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKER 66 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 25.8 bits (54), Expect = 1.6 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S +++ + +++ K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKI 81 Score = 24.2 bits (50), Expect = 4.8 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKER 66 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 25.8 bits (54), Expect = 1.6 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S +++ + +++ K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKI 81 Score = 24.2 bits (50), Expect = 4.8 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKER 66 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 25.8 bits (54), Expect = 1.6 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S +++ + +++ K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKI 81 Score = 24.2 bits (50), Expect = 4.8 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKER 66 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.8 bits (54), Expect = 1.6 Identities = 13/45 (28%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E+E + KE+ Sbjct: 244 LHNEKEKLLEERTSRKRYSRSREREQKSYKNEREYRKYGKTSKER 288 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 25.8 bits (54), Expect = 1.6 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S +++ + +++ K+ Sbjct: 257 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSKEPKI 314 Score = 24.2 bits (50), Expect = 4.8 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYRETSKER 299 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 25.4 bits (53), Expect = 2.1 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N R+ E+S ++K + +++ K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQNSYKNEKEYRKYRERSKERSRDKRERERSKERKI 81 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEKEYRKYRERSKER 66 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 25.4 bits (53), Expect = 2.1 Identities = 12/58 (20%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N R+ E+S ++K + +++ K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQNSYKNEKEYRKYRERSKERSRDKRERERSKERKI 81 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEKEYRKYRERSKER 66 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.4 bits (53), Expect = 2.1 Identities = 13/45 (28%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E++ E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNERKYRKYRERSKER 66 Score = 24.6 bits (51), Expect = 3.6 Identities = 11/58 (18%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N R+ E+S ++++ + + + K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNERKYRKYRERSKERSRDRTERERSREPKI 81 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 66 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 66 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 66 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 23/45 (51%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E+ + + +R+ E+KS E+E E +E+ Sbjct: 22 LYNEKEKFLEEKTSRKRYSRSREREQKSYKNEREYREYRETSRER 66 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 23/45 (51%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E+ + + +R+ E+KS E+E E +E+ Sbjct: 22 LYNEKEKFLEEKTSRKRYSRSREREQKSYKNEREYREYRETSRER 66 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 23/45 (51%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E+ + + +R+ E+KS E+E E +E+ Sbjct: 22 LYNEKEKFLEEKTSRKRYSRSREREQKSYKNEREYREYRETSRER 66 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 23/45 (51%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E+ + + +R+ E+KS E+E E +E+ Sbjct: 22 LYNEKEKFLEEKTSRKRYSRSREREQKSYKNEREYREYRETSRER 66 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 66 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 66 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 66 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 66 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 66 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 66 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 66 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 66 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 66 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 21 LHNEKEKLLEERTNRKRNSRSREREQNSYKNEREYRKYRETSKER 65 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 21 LHNEKEKLLEERTNRKRNSRSREREQNSYKNEREYRKYRETSKER 65 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEKEYRKYRETSKER 66 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 244 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKER 288 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 25.0 bits (52), Expect = 2.7 Identities = 12/58 (20%), Positives = 25/58 (43%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E S +++ + + + K+ Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQRSYKNENSYRKYRETSKERSRDRIERERSREPKI 314 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+ S E+E E KE+ Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRERSKER 299 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/58 (18%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N R+ E+S ++++ + + + K+ Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRERSKERSRDRTERERSREPKI 314 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 25.0 bits (52), Expect = 2.7 Identities = 12/58 (20%), Positives = 24/58 (41%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N K L E + +R + RE+ N N R+ E S +++ + + ++ Sbjct: 257 NEKKKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRRERGRSREHRI 314 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 255 LHNEKKKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKER 299 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/45 (28%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E++ E KE+ Sbjct: 22 LYNEKEKLLEERTSRKRYSRSREREQKSYKNERKYRKYRERSKER 66 Score = 24.6 bits (51), Expect = 3.6 Identities = 11/58 (18%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N R+ E+S ++++ + + + K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNERKYRKYRERSKERSRDRTERERSREPKI 81 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 66 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 66 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 66 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 66 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 66 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 66 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 66 >AY569719-1|AAS86672.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 315 >AY569718-1|AAS86671.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 315 >AY569715-1|AAS86668.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 315 >AY569714-1|AAS86667.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 315 >AY569713-1|AAS86666.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 315 >AY569711-1|AAS86664.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 315 >AY569702-1|AAS86655.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 270 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 314 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L + + LRE + + +R+ E+KS E+E E +E+ Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRER 315 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.8 bits (49), Expect = 6.3 Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 385 LTSEEMALRREKARQLREELKQNNANINRQSEE 417 + + E ALR E+A+++ + ++NAN + QS E Sbjct: 238 VVNHEKALR-EQAKKMNVDSLRSNANTSSQSAE 269 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 6.3 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Query: 506 LEDIDEAVAGNIIGIGGLEEHVLKTAT--LSSTVACPAFSEMQYSVVPILRV 555 LE + + G+I I G E+H KTA + S V A S V +LR+ Sbjct: 182 LEMSVDFIKGSISNIDGAEDHCNKTAVRKVISGVVGAASSVTSIQVANLLRL 233 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.4 bits (48), Expect = 8.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 769 NCGPNMLLNHTADYCTKYLHHEK 791 NCGPN + T + CT L ++ Sbjct: 429 NCGPNPCTHTTTNGCTAELRKKE 451 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.4 bits (48), Expect = 8.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 769 NCGPNMLLNHTADYCTKYLHHEK 791 NCGPN + T + CT L ++ Sbjct: 415 NCGPNPCTHTTTNGCTAELRKKE 437 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.4 bits (48), Expect = 8.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 769 NCGPNMLLNHTADYCTKYLHHEK 791 NCGPN + T + CT L ++ Sbjct: 449 NCGPNPCTHTTTNGCTAELRKKE 471 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.4 bits (48), Expect = 8.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 769 NCGPNMLLNHTADYCTKYLHHEK 791 NCGPN + T + CT L ++ Sbjct: 398 NCGPNPCTHTTTNGCTAELRKKE 420 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 8.4 Identities = 10/58 (17%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + E + +R + RE+ N N R+ + S ++++ + +++ K+ Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKI 81 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 8.4 Identities = 10/58 (17%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + E + +R + RE+ N N R+ + S ++++ + +++ K+ Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKI 81 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 8.4 Identities = 10/58 (17%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + E + +R + RE+ N N R+ + S ++++ + +++ K+ Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKI 81 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 8.4 Identities = 10/58 (17%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + E + +R + RE+ N N R+ + S ++++ + +++ K+ Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKI 81 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 8.4 Identities = 10/58 (17%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + E + +R + RE+ N N R+ + S ++++ + +++ K+ Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKI 81 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.4 bits (48), Expect = 8.4 Identities = 10/58 (17%), Positives = 26/58 (44%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + E + +R + RE+ N N R+ + S ++++ + +++ K+ Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYRKTSKERSRDRTERERSKEPKI 81 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + +R+ E+K E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKER 66 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + +R+ E+K E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKER 66 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + +R+ E+K E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKER 66 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + +R+ E+K E+E E KE+ Sbjct: 22 LHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKER 66 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKER 66 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/58 (18%), Positives = 25/58 (43%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E ++++ + + + K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKERSRDRTERERSREPKI 81 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKER 66 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/58 (18%), Positives = 25/58 (43%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E ++++ + + + K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKERSRDRTERERSREPKI 81 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKER 66 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/58 (18%), Positives = 25/58 (43%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E ++++ + + + K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKERSRDRTERERSREPKI 81 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + + +R+ E+KS E E KE+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKER 66 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/58 (18%), Positives = 25/58 (43%) Query: 380 NRPKALTSEEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEKV 437 N + L E + +R + RE+ N N R+ E ++++ + + + K+ Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETWKERSRDRTERERSREPKI 81 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + +R+ E+K E+E E KE+ Sbjct: 255 LHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKER 299 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + +R+ E+K E+E E KE+ Sbjct: 255 LHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKER 299 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + +R+ E+K E+E E KE+ Sbjct: 255 LHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKER 299 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + +R+ E+K E+E E KE+ Sbjct: 255 LHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKER 299 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + +R+ E+K E+E E KE+ Sbjct: 255 LHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKER 299 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 392 LRREKARQLREELKQNNANINRQSEEKSPHEEQEKSAEDENEKEK 436 L EK + L E + +R+ E+K E+E E KE+ Sbjct: 244 LHNEKEKLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKER 288 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 23.4 bits (48), Expect = 8.4 Identities = 9/39 (23%), Positives = 22/39 (56%) Query: 388 EEMALRREKARQLREELKQNNANINRQSEEKSPHEEQEK 426 +EM RE+ R+ RE + + +Q +++ ++Q++ Sbjct: 67 KEMEQMREREREQREHSDRVTSQQQQQQQQQQQQDQQQQ 105 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.133 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 254,723 Number of Sequences: 429 Number of extensions: 11222 Number of successful extensions: 180 Number of sequences better than 10.0: 103 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 40 Number of HSP's gapped (non-prelim): 142 length of query: 902 length of database: 140,377 effective HSP length: 64 effective length of query: 838 effective length of database: 112,921 effective search space: 94627798 effective search space used: 94627798 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -