BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001521-TA|BGIBMGA001521-PA|undefined (66 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL513122-2|CAI14412.1| 163|Homo sapiens chromosome 9 open readi... 27 9.5 AF220263-1|AAF89164.1| 163|Homo sapiens MOST2 protein. 27 9.5 >AL513122-2|CAI14412.1| 163|Homo sapiens chromosome 9 open reading frame 31 protein. Length = 163 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Query: 12 DERLWLTIIRVQSGRPYRNQHVVAAASTRYGTQVPS 47 ++R L++IR SG P + AAAST T+VPS Sbjct: 109 EQRRTLSLIRKTSGTPTESTVATAAAST---TEVPS 141 >AF220263-1|AAF89164.1| 163|Homo sapiens MOST2 protein. Length = 163 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Query: 12 DERLWLTIIRVQSGRPYRNQHVVAAASTRYGTQVPS 47 ++R L++IR SG P + AAAST T+VPS Sbjct: 109 EQRRTLSLIRKTSGTPTESTVATAAAST---TEVPS 141 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.320 0.133 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,948,957 Number of Sequences: 224733 Number of extensions: 342999 Number of successful extensions: 381 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 381 Number of HSP's gapped (non-prelim): 2 length of query: 66 length of database: 73,234,838 effective HSP length: 45 effective length of query: 21 effective length of database: 63,121,853 effective search space: 1325558913 effective search space used: 1325558913 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -