BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001519-TA|BGIBMGA001519-PA|undefined (58 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0815 + 11477618-11477845,11478206-11478337,11480227-114804... 25 5.9 02_01_0408 - 2972240-2975380 25 5.9 >03_02_0815 + 11477618-11477845,11478206-11478337,11480227-11480408, 11480500-11480662,11481480-11481794 Length = 339 Score = 25.4 bits (53), Expect = 5.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 2 KKPCNKIAKDDALLAIIPSDI 22 +KP K KD +LL I+PS + Sbjct: 181 RKPMQKSGKDHSLLLILPSGV 201 >02_01_0408 - 2972240-2975380 Length = 1046 Score = 25.4 bits (53), Expect = 5.9 Identities = 12/37 (32%), Positives = 19/37 (51%) Query: 17 IIPSDINTEGRKGLFVLAASLCIAAGRSPLTTWTITD 53 +IP D +G + L L+ C +GR PL +T+ Sbjct: 439 VIPQDETIDGFENLQALSVDHCSLSGRIPLWLSKLTN 475 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.317 0.131 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,598,983 Number of Sequences: 37544 Number of extensions: 44222 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 87 Number of HSP's gapped (non-prelim): 2 length of query: 58 length of database: 14,793,348 effective HSP length: 38 effective length of query: 20 effective length of database: 13,366,676 effective search space: 267333520 effective search space used: 267333520 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -