BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001518-TA|BGIBMGA001518-PA|undefined (398 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 25 1.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 25 1.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 25 1.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 25 1.3 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 22 8.9 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.6 bits (51), Expect = 1.3 Identities = 15/49 (30%), Positives = 22/49 (44%) Query: 185 IKNLSSNSINTENLIEGSGIKLRRYELNGSDNNLSHHNVASKGNGNDES 233 ++ L+ + E I+ SG RR ++ S HH A G DES Sbjct: 1141 LEMLNKRLDHIEKTIDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDES 1189 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.6 bits (51), Expect = 1.3 Identities = 15/49 (30%), Positives = 22/49 (44%) Query: 185 IKNLSSNSINTENLIEGSGIKLRRYELNGSDNNLSHHNVASKGNGNDES 233 ++ L+ + E I+ SG RR ++ S HH A G DES Sbjct: 1141 LEMLNKRLDHIEKTIDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDES 1189 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.6 bits (51), Expect = 1.3 Identities = 15/49 (30%), Positives = 22/49 (44%) Query: 185 IKNLSSNSINTENLIEGSGIKLRRYELNGSDNNLSHHNVASKGNGNDES 233 ++ L+ + E I+ SG RR ++ S HH A G DES Sbjct: 1141 LEMLNKRLDHIEKTIDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDES 1189 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.6 bits (51), Expect = 1.3 Identities = 15/49 (30%), Positives = 22/49 (44%) Query: 185 IKNLSSNSINTENLIEGSGIKLRRYELNGSDNNLSHHNVASKGNGNDES 233 ++ L+ + E I+ SG RR ++ S HH A G DES Sbjct: 1141 LEMLNKRLDHIEKTIDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDES 1189 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.8 bits (44), Expect = 8.9 Identities = 10/37 (27%), Positives = 17/37 (45%) Query: 5 IKCVSCNIVIDELLAYIQNKILIADEASLVKICASAF 41 + C + ELL + IL+ + L+ CAS + Sbjct: 51 VYCSVTFFALSELLTDLATSILLKVSSLLIGFCASIY 87 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.129 0.356 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,618 Number of Sequences: 317 Number of extensions: 3140 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 398 length of database: 114,650 effective HSP length: 58 effective length of query: 340 effective length of database: 96,264 effective search space: 32729760 effective search space used: 32729760 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -