BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001517-TA|BGIBMGA001517-PA|undefined (96 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 0.56 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 19 6.9 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 0.56 Identities = 10/17 (58%), Positives = 13/17 (76%) Query: 49 SSSTGDNHAAFSSVSTH 65 SSST N++A+SS S H Sbjct: 143 SSSTWCNYSAYSSASRH 159 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 19.4 bits (38), Expect = 6.9 Identities = 10/31 (32%), Positives = 13/31 (41%) Query: 20 TSPAWQLCITWTTHDTHATFKLSLDSPQTSS 50 TSP W T T T T + P T++ Sbjct: 1048 TSPWWTTTTTRRTTTTRPTTTSTTTRPTTTN 1078 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.123 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,992 Number of Sequences: 317 Number of extensions: 546 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 96 length of database: 114,650 effective HSP length: 48 effective length of query: 48 effective length of database: 99,434 effective search space: 4772832 effective search space used: 4772832 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (20.1 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -