BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001517-TA|BGIBMGA001517-PA|undefined (96 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 3.5 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 19 8.1 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 20.6 bits (41), Expect = 3.5 Identities = 8/18 (44%), Positives = 9/18 (50%) Query: 4 LQFIAAHDRIINAWGHTS 21 L A D + WGHTS Sbjct: 284 LDSFAGSDVTVLGWGHTS 301 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 19.4 bits (38), Expect = 8.1 Identities = 10/33 (30%), Positives = 15/33 (45%) Query: 32 THDTHATFKLSLDSPQTSSSTGDNHAAFSSVST 64 +H++ L+ P SSST S+ ST Sbjct: 307 SHESQCPMLQKLEKPVLSSSTTTTSPMTSTKST 339 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.123 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,157 Number of Sequences: 429 Number of extensions: 594 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 96 length of database: 140,377 effective HSP length: 49 effective length of query: 47 effective length of database: 119,356 effective search space: 5609732 effective search space used: 5609732 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.5 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -