BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001516-TA|BGIBMGA001516-PA|undefined (63 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88180-12|AAO21402.1| 476|Caenorhabditis elegans Hypothetical p... 25 5.0 U88180-11|AAO21401.1| 566|Caenorhabditis elegans Hypothetical p... 25 5.0 U88180-10|AAO21403.1| 532|Caenorhabditis elegans Hypothetical p... 25 5.0 U88180-9|AAM22071.1| 517|Caenorhabditis elegans Hypothetical pr... 25 5.0 U88180-8|AAB42296.1| 607|Caenorhabditis elegans Hypothetical pr... 25 5.0 >U88180-12|AAO21402.1| 476|Caenorhabditis elegans Hypothetical protein T27A3.1d protein. Length = 476 Score = 25.4 bits (53), Expect = 5.0 Identities = 10/31 (32%), Positives = 20/31 (64%) Query: 3 QDSDDTALAERVRGFKSDPEKVREATEFVDQ 33 + + D AL ER++ KS+ E++R+ + + Q Sbjct: 99 RSNSDEALRERLKSTKSENERLRQECDLLRQ 129 >U88180-11|AAO21401.1| 566|Caenorhabditis elegans Hypothetical protein T27A3.1c protein. Length = 566 Score = 25.4 bits (53), Expect = 5.0 Identities = 10/31 (32%), Positives = 20/31 (64%) Query: 3 QDSDDTALAERVRGFKSDPEKVREATEFVDQ 33 + + D AL ER++ KS+ E++R+ + + Q Sbjct: 99 RSNSDEALRERLKSTKSENERLRQECDLLRQ 129 >U88180-10|AAO21403.1| 532|Caenorhabditis elegans Hypothetical protein T27A3.1e protein. Length = 532 Score = 25.4 bits (53), Expect = 5.0 Identities = 10/31 (32%), Positives = 20/31 (64%) Query: 3 QDSDDTALAERVRGFKSDPEKVREATEFVDQ 33 + + D AL ER++ KS+ E++R+ + + Q Sbjct: 140 RSNSDEALRERLKSTKSENERLRQECDLLRQ 170 >U88180-9|AAM22071.1| 517|Caenorhabditis elegans Hypothetical protein T27A3.1b protein. Length = 517 Score = 25.4 bits (53), Expect = 5.0 Identities = 10/31 (32%), Positives = 20/31 (64%) Query: 3 QDSDDTALAERVRGFKSDPEKVREATEFVDQ 33 + + D AL ER++ KS+ E++R+ + + Q Sbjct: 140 RSNSDEALRERLKSTKSENERLRQECDLLRQ 170 >U88180-8|AAB42296.1| 607|Caenorhabditis elegans Hypothetical protein T27A3.1a protein. Length = 607 Score = 25.4 bits (53), Expect = 5.0 Identities = 10/31 (32%), Positives = 20/31 (64%) Query: 3 QDSDDTALAERVRGFKSDPEKVREATEFVDQ 33 + + D AL ER++ KS+ E++R+ + + Q Sbjct: 140 RSNSDEALRERLKSTKSENERLRQECDLLRQ 170 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.312 0.129 0.347 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,115,423 Number of Sequences: 27539 Number of extensions: 23403 Number of successful extensions: 60 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 55 Number of HSP's gapped (non-prelim): 5 length of query: 63 length of database: 12,573,161 effective HSP length: 43 effective length of query: 20 effective length of database: 11,388,984 effective search space: 227779680 effective search space used: 227779680 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -